KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2099Help
Entry
RSP_2099          CDS       T00284                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RSP_2099 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RSP_2099 (murE)
Enzymes [BR:rsp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     RSP_2099 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:698574..700061
Genome map
AA seq 495 aa AA seqDB search
MADRAATLSALGLTPAGGRGGDIAVTGLAVDSRQVRPGTLFAALPGSRSHGASFVPAALA
AGATAILTDAAGAALAREALAGSGAALVLAEDPRQTLAGAAALWFGRQPATVVAVTGTNG
KTSVATFTRQIWAALGHAAINIGTTGVEGAFAAPSAHTTPEPITLHRLLAEAAEAGVTHA
AMEASSHGLEQRRLDGVHLAAAGFTNFTQDHLDYHETFEAYFAAKAGLFTRVLPDEGTAV
VNLDDPRGPEIAALARARAQRVIGTGFHADADLRLLSQRFDATGQDLRFSWQGEVHLARL
PLIGGFQAWNVAVAASLAIGAGDAPERVFATFSRLQGVRGRMQLAATRKNGASVFVDYAH
TPDALATALKALRPHVMGRIVVVFGAGGDRDRGKRPLMGRAAADHADVLYVTDDNPRTED
PAAIRRAILEACPEAHEVGDRAEAILRGVDALTPGDALLIAGKGHESGQVVGTDIFPFDD
AEQASIATAALDGLI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcgcgcagcaacactctcggcgctcgggctcacgcccgcaggcggccgcgga
ggcgacatcgccgtgaccggcctcgcggttgacagccggcaagtgcgccccggcaccctc
ttcgcggcgctgcccggctcccgcagccacggcgcgagcttcgtgccggcggcgctcgcc
gcaggcgccaccgcgatcctcaccgatgccgccggcgcggcgctcgcgcgcgaggcgctc
gcgggctcgggcgcggccctcgtcctggccgaggatccccgccagaccctcgccggcgcg
gccgccctctggttcggccgccagcccgcgaccgtggtcgccgtaacgggcaccaacggc
aagacctcggtcgcgaccttcacccgccagatctgggcggccctcggccatgccgcgatc
aacatcggcacgaccggcgtcgagggcgccttcgcagccccctccgcccataccacgccc
gagcccatcaccctccaccggctcctcgccgaggcggccgaggcgggcgtcacccatgcc
gccatggaggcctcctcccacgggctcgagcagcgccgcctcgacggcgtgcatctcgcg
gccgcgggcttcaccaacttcacccaggaccatctcgactatcacgagaccttcgaggcc
tatttcgccgccaaggccgggctcttcacccgggtcttgcccgacgagggcacggcggtc
gtcaatctcgacgatccccgcggccccgagatcgcggccctcgcgcgggcgcgcgcgcaa
cgggtgatcggcacgggctttcacgccgatgcggacctgcgccttctctcgcagcgcttc
gacgcgaccgggcaggacctccgcttctcctggcagggcgaggtgcatctcgcgcgtctg
ccgctgatcggcggcttccaggcctggaacgtcgcggtcgcggccagcctcgccatcggc
gcgggcgacgcccccgagcgggtcttcgccaccttctcccggcttcagggcgtgcgcggg
cggatgcagctcgccgccacccgcaagaacggtgcctcggtcttcgtcgattatgcccat
acgcccgacgccctcgccaccgccctcaaggcgctgcgcccgcatgtgatggggcgcatc
gtcgtcgtcttcggtgccggcggcgaccgcgaccgcggcaagcgcccgctgatgggccgc
gccgcggcagaccatgccgacgtgctctatgtcaccgacgacaatccccgcaccgaggat
cccgccgccatccgccgcgccatcctcgaggcctgccccgaggcgcatgaggtgggcgac
cgggccgaggccatcctgcgcggcgtcgatgcgctcacgccgggcgacgcgctcctcatc
gcgggcaagggccacgaatcgggccaggtggtgggcaccgacatcttccccttcgacgat
gccgaacaggcgagcatcgccaccgccgcgctggacgggctgatatga

DBGET integrated database retrieval system