KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2196Help
Entry
RSP_2196          CDS       T00284                                 

Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00071  Fatty acid degradation
rsp00280  Valine, leucine and isoleucine degradation
rsp00281  Geraniol degradation
rsp00310  Lysine degradation
rsp00362  Benzoate degradation
rsp00380  Tryptophan metabolism
rsp00410  beta-Alanine metabolism
rsp00640  Propanoate metabolism
rsp00650  Butanoate metabolism
rsp00903  Limonene and pinene degradation
rsp00930  Caprolactam degradation
rsp01040  Biosynthesis of unsaturated fatty acids
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01120  Microbial metabolism in diverse environments
rsp01130  Biosynthesis of antibiotics
rsp01200  Carbon metabolism
rsp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RSP_2196
   00650 Butanoate metabolism
    RSP_2196
  Lipid metabolism
   00071 Fatty acid degradation
    RSP_2196
   01040 Biosynthesis of unsaturated fatty acids
    RSP_2196
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSP_2196
   00310 Lysine degradation
    RSP_2196
   00380 Tryptophan metabolism
    RSP_2196
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSP_2196
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RSP_2196
   00281 Geraniol degradation
    RSP_2196
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSP_2196
   00930 Caprolactam degradation
    RSP_2196
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RSP_2196
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RSP_2196
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RSP_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO UDPG_MGDP_dh_N 2-Hacid_dh_C DFP Pyr_redox_2 NAD_binding_8 FAD_binding_3 Sacchrp_dh_NADP XdhC_C F420_oxidored Shikimate_DH NAD_Gly3P_dh_N GIDA
Motif
Other DBs
NCBI-GeneID: 3719725
NCBI-ProteinID: YP_352252
UniProt: Q3J4D3
Position
1:complement(809379..811580)
Genome map
AA seq 733 aa AA seqDB search
MTDFTSRTDADGVCTITWDVPGKSMNVMSMAGFAELDGLIAAALGDPSVKGVILTSGKKD
FAAGMDLNVIARMKEEGGDDPARAVFEGVMEMHAVLRRIERAGMDPKTLKGGKPIVAALP
GTALGLGLELPLACHRIIAADNPKAKIGLPEIMVGIFPGGGGTTRLVRRLGAMMAAPLLL
EGKLNDPKGAKAMGVVDEVVPADQLLPRAKEWVLGAKDADLVKPWDAKGYKMPGGAPYHP
AGFMTFVGASAMVTGKTMGVYPAAKGLLAAVYEGALVPFDTALKIEARWFTHVLMNPSSS
AMIRSLFINKEALEKGAVRPALPDQSVRKLGVIGAGMMGAGIAHVAANAGIEVVLIDATQ
EAADRGKSHSEGLLDKGMKRGKVSAEKKAEVLGRIAATTDYAALSGCDLIVEAVFEDPAV
KAEVTQKVEAAVGPDCIFATNTSTLPISGLAKASRDPAQFIGIHFFSPVDKMMLVEIIRG
KATGDRAVAKALDFVRQIRKTPIVVHDARFFYANRCIIPYLNEGIRMVAEGVAPALIENA
AKLVGMPLGPLQLVDETSIDLGVKIAKATKAALGEAYPDAAVDAVIFPLADEGRLGRKAG
AGFYAYDAAGKREGLWPGLADRWPQAEAQPELAEVQHRLLFAQVLEAVRALEEGVLTDIR
EGDVGAILGWGFAPWSGGPFSWLDMIGAPRAVEICEGLAERHGSRFAPPKLLVEMAGKGE
SFYARFAPQARAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaccagccggaccgacgcggacggggtctgcaccatcacctgggacgtg
ccgggcaagtcgatgaacgtcatgtcgatggcgggatttgccgagctcgacgggctgatc
gccgcggcgctcggcgatccgtctgtcaagggcgtgatcctcacctcgggcaagaaggac
tttgccgcggggatggatctcaatgtcatcgcccgcatgaaggaggaaggcggcgacgat
ccggcccgggccgtgttcgagggcgtgatggagatgcatgccgtcctgcgccggatcgag
cgcgcgggcatggatccgaagacgctgaaggggggcaagcccatcgtggcggccctgccc
ggcaccgccctgggcctggggctcgagctgccgctggcctgccaccgcatcatcgcggcc
gacaatcccaaggccaagatcggcctgcccgagatcatggtggggatcttccccggcggc
ggcggcacgacgcggctcgtccgcaggctcggcgccatgatggcggctcccctcctcctc
gagggcaagctgaacgatcccaagggcgccaaggccatgggtgtcgtcgacgaggtggtg
ccggccgatcagctgctcccgcgggcgaaggaatgggtgctcggcgcgaaggacgcggat
ctggtgaagccgtgggacgccaagggctacaagatgcctggcggcgcgccctaccatccg
gcgggcttcatgaccttcgtcggcgcctcggccatggtgacgggcaagacgatgggcgtc
tatccggcggccaagggcctgctcgccgcggtctacgagggcgcgctcgtgcccttcgac
accgcgctgaagatcgaggcgcgctggttcacccatgtgctgatgaatccctcctcgtcg
gcgatgatccggtcgctcttcatcaacaaggaggcgctggagaagggcgccgtccgccct
gccctgcccgaccagtcggtccggaagctgggcgtgatcggggcgggcatgatgggcgcg
ggcatcgcccatgtcgcggccaatgcgggcatcgaggtcgtgctgatcgacgcgacgcag
gaggcggccgaccgcggcaagtcccattcggaaggtctcctcgacaaggggatgaagcgg
ggcaaggtctcggccgagaagaaggccgaggtgctgggccggatcgccgccaccaccgac
tatgcggccctctcgggctgcgatctgatcgtcgaggcggtgttcgaggatcccgcggtg
aaggccgaggtcactcagaaggtcgaggccgcggtcgggcccgactgtatcttcgcaacc
aacacctcgaccctgccgatctcggggttggccaaggcgagccgcgatccggcgcagttc
atcggcatccatttcttctcgcccgtggacaagatgatgctggtcgagatcatccgcggc
aaggccaccggcgaccgcgccgtggccaaggcgctcgatttcgtgcgccagatccgcaag
acgcccatcgtcgtccacgatgcgcgcttcttctacgccaaccgctgcatcatcccctac
ctcaacgaggggatccgcatggtggccgaaggcgtggcgcccgcgctgatcgagaatgcg
gcgaagctggtggggatgccgctcggcccccttcagctggtggacgaaacctcgatcgac
ctcggggtgaagatcgccaaggccacgaaggccgccctgggcgaggcctatccggacgcg
gcggtggatgcggtgatcttcccgctggcggacgaggggcggctcggccgcaaggcgggc
gcgggcttctatgcctacgacgccgccggcaagcgcgaaggtctctggccgggcctcgcc
gaccgctggccgcaggccgaggcgcagcccgagcttgccgaggtgcagcaccggcttctc
ttcgcgcaggtgctcgaggcggtgcgcgcgctcgaggagggcgtgctgaccgacatccgc
gagggcgacgtgggcgccattctcggctggggcttcgcgccctggtcgggcggcccgttc
agctggctcgacatgatcggcgcgccgcgcgcggtggagatctgcgaggggctggccgag
cgtcacggcagccgcttcgcgccgccgaagctgctggtcgagatggccggcaagggcgag
agcttctacgcccgcttcgcaccgcaggcccgcgcggcctga

DBGET integrated database retrieval system