KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2334Help
Entry
RSP_2334          CDS       T00284                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSP_2334 (pfkB)
   01230 Biosynthesis of amino acids
    RSP_2334 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_2334 (pfkB)
   00030 Pentose phosphate pathway
    RSP_2334 (pfkB)
   00051 Fructose and mannose metabolism
    RSP_2334 (pfkB)
   00052 Galactose metabolism
    RSP_2334 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    RSP_2334 (pfkB)
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RSP_2334 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(961655..962599)
Genome map
AA seq 314 aa AA seqDB search
MIPILTLTLNPAIDLAADVPQVLPGIKLRCTEPRVDPGGGGLNVSRAIRILGGRSTAFVA
LGGNIGGRLAALVAAAGIEIVAFSGPGETRESLTVTETATGRQFRFMLPGAAWDAERVEA
ALARIDRAVPEGGMVVLSGSLPPGVPADFPAMVSRVLGKRARLLVDTSGAPLAHLAAGGV
PDLDILRMDDGEAASLAGRPLACASETADFASSLVARGVAECVIVARGADGSVLADARGR
WHARSEPVEVVSAVGAGDTFVGAFVLALSRGAPPEEALAHGVAGAAAAVLTEATELCHPE
DVARLLPSAAATAL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatccccattctcacgttgacgctgaacccggcgatcgacctcgctgccgacgtgccg
caggtcctgccgggcatcaagctgcgctgcaccgagccccgggtcgatccgggcggcggc
gggctgaacgtcagccgcgccatccgcatcctcggcggccggagcaccgccttcgtggcc
ctcggcggcaacatcggcgggcggctggccgccctggtcgcggcggccggcatcgagatc
gtggccttctcgggccccggcgagacgcgcgaaagcctcaccgtcaccgaaacggccacg
ggccggcagttccgcttcatgctgccgggcgccgcctgggacgcagagcgcgtcgaggcc
gctctggcccggatcgaccgcgccgtgcccgaaggcggcatggtggtgctctcgggctcg
ctgccgcccggcgtgccggccgacttcccggccatggtctcccgggtgctgggcaagcgc
gcccggcttctggtcgacacgtccggcgcgccgctcgcccatctggcggcgggcggggtg
cccgacctcgacatcctgcggatggacgatggcgaggccgcgagccttgccggccgcccc
ctcgcctgcgcctccgaaacggccgatttcgcctcaagcctcgtggcccgcggcgtggcc
gagtgcgtgatcgtcgcccgcggcgccgacggatcggtcctcgccgatgcccgcggccgc
tggcacgcccgctccgaaccggtcgaggtggtgagcgcggtgggtgcgggcgacacgttc
gtcggcgccttcgtcctcgccctctcgcggggcgccccgccggaggaggcgctggcccat
ggcgtggccggcgccgcggcggccgtcctcaccgaggcgaccgaactctgccatcccgag
gatgtggcgcgcctcctgccctccgccgccgcgacggccctctga

DBGET integrated database retrieval system