KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2364Help
Entry
RSP_2364          CDS       T00284                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (Class II) (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    RSP_2364 (fucA)
Enzymes [BR:rsp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     RSP_2364 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:991228..991884
Genome map
AA seq 218 aa AA seqDB search
MNEMSDLSDLAKREEIIRQCLEMNRSGLNQGTSGNISVRHGEGMLITPTSLPYDTLVPED
IVFVSMEGEVRGRHKPSSEWRFHRDILRERADVNAVVHAHPTYCTTLAIMNREIPSIHYM
LAVVGGPNIRCAPYAIYGSEELSRNAVEALHDRKACLLEHHGMIAVGKSLAQAMWLAVEV
ETLARQYHGCLQIGEPRLLSERQIQDVIDKIAGYGHQG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagatgagcgatctgtccgacctcgccaagcgcgaagagatcatccgccagtgt
ctcgagatgaaccgctcgggcctcaatcagggcacctcgggcaacatctctgtgcgccat
ggcgaggggatgctgatcacccccacgtcgctgccctacgacacgctggtgcccgaggac
atcgtcttcgtctcgatggagggcgaggtgcggggccggcacaagccgtcgagcgaatgg
cgctttcaccgcgacatcctgcgcgagcgggcggacgtgaatgcggtggtgcatgcgcat
ccgacctactgcaccacgctcgccatcatgaaccgcgagatcccctcgatccactacatg
ctggcggtggtgggcggcccgaacatccgctgcgcgccctacgcgatctacggttcggag
gagctgtcgcggaacgcggtcgaggcgctgcacgaccgcaaggcgtgccttctcgaacat
cacggcatgatcgccgtgggcaagagcctcgcgcaggccatgtggctcgccgtcgaggtc
gagacgctggcccggcagtatcacggctgccttcagatcggcgagccgcggctgctgagc
gagcggcagatccaggacgtgatcgacaagatcgccggctacggccaccagggctga

DBGET integrated database retrieval system