KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2389Help
Entry
RSP_2389          CDS       T00284                                 

Definition
putative glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rsp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rsp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1018128..1018658
Genome map
AA seq 176 aa AA seqDB search
MTVRPHLALAFACLAGPALAAGPPPVTFDSIDGGQIRLDELRTAGPVLVVNTASLCGFTP
QYDDLQALWDRYRDAGLTVLAVPSNDFKQELDDAGAVRDFCATNFDLTLPMTTITPVTGA
EAHPFYRWLAEEHGVEPRWNFHKVLIDRDGDLVASWSSPVRPTDREIVGRIEALLP
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccgtccgcaccttgcgctcgcctttgcctgtctcgccgggcccgccctcgcc
gcggggccgccgccggtcaccttcgactcgatcgacggcgggcagatccgcctcgacgag
ctgcgtacggcaggcccggtgctggtggtgaacacggcctcgctctgcggcttcaccccg
caatacgacgatcttcaggcgctctgggatcgctaccgcgacgcggggctgacggtcctc
gccgtgccgtcgaacgatttcaagcaggagctggacgatgcgggcgcggtgcgcgacttc
tgcgccaccaacttcgacctgacactgcccatgaccaccatcactccggtgacgggggcc
gaggcccatcccttctaccgctggctcgcagaggagcatggggtcgagccgcgctggaac
ttccacaaggttctgatcgaccgtgacggggatctggtggcgagctggtcctcgccggtg
cggccgacggaccgcgagatcgtgggccggatcgaggcgctcctgccgtga

DBGET integrated database retrieval system