KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2395Help
Entry
RSP_2395          CDS       T00284                                 

Definition
BCCP, cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RSP_2395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1022601..1023644
Genome map
AA seq 347 aa AA seqDB search
MRLTLTVLIATTALAGAAQADALRDKALGYFAPLPSTVPAVKDNRITPEKIELGKALFFD
PRLSASGVFSCYSCHNLTTGGDDNLETSIGHGWQKGPRNAPTVLNAVLNEAQFWDGRADD
LKAQAKGPVQAGVEMANTPGQVEVTLKSLPQYVDWFAAAFPGEPEPTSFDNMAKAIEAFE
ATLITPAPFDAFLNGDDAALTEDQRAGLDLFIDKGCSTCHSGVNVGGHGYYPFGLIEKPG
ADILPEGDKGRFAVTATVDDEYVFRAAPLRNVAVTAPYFHSGKVWDLKTAVTIMAESQLG
ETMSDQEVGQVVAFLESLTGTMPPVTLPVLPAETAGTPRPTAEIRVE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgaccctcaccgtcctgatcgcgacgacggccctcgccggcgcggctcaggcc
gacgccctccgggacaaggctctgggatattttgccccgctgccctcgacggttccggcc
gtgaaggacaaccgcatcaccccggagaagatcgagctcggcaaggcgctcttcttcgat
ccgcgtctgtcggcctcgggcgtcttctcctgctattcctgccacaacctcaccacgggc
ggcgacgacaacctcgagacctcgatcggccacggctggcagaaggggccgcggaacgcg
cccaccgtgctcaatgcggtgctgaacgaggcgcagttctgggacgggcgggccgacgac
ctgaaggcgcaggccaaggggccggtgcaggcgggcgtcgagatggcgaacacgcccggg
caggtcgaggtgacgctgaaatccctgccgcaatatgtcgactggttcgccgccgccttc
ccgggcgagccggagcccaccagcttcgacaacatggccaaggccatcgaggccttcgag
gcgacgctcatcacgcctgcgcccttcgacgccttcctgaacggcgacgatgcggccctg
accgaggatcagcgggcgggactcgatctcttcatcgacaagggctgctcgacctgccac
tcgggcgtgaacgtgggcgggcacggctactatccgttcggcctgatcgagaagcccggc
gcggacatcctgcccgagggcgacaagggccgtttcgcggtgacggccacggtggacgac
gaatatgtcttccgggcggcgccgctgcgcaacgtggcggtcacggcgccctacttccac
tcgggcaaggtgtgggacctgaagaccgccgtcacgatcatggccgagagccagctcggc
gagacgatgagcgatcaggaggtggggcaggtcgtggccttcctcgagagcctcacgggg
accatgccgccggtcacgctgccggtgctgccggccgagacggcaggcacgccgcgcccc
acggccgagatccgggtcgagtga

DBGET integrated database retrieval system