KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2418Help
Entry
RSP_2418          CDS       T00284                                 

Gene name
pldB
Definition
(RefSeq) putative Esterase/lipase/thioesterase
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RSP_2418 (pldB)
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RSP_2418 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Thioesterase
Motif
Other DBs
NCBI-GeneID: 3720016
NCBI-ProteinID: YP_352481
UniProt: Q3J3Q4
Position
1:complement(1050462..1051415)
Genome map
AA seq 317 aa AA seqDB search
MSGAPFHAALARGPARAHADWIRTGDGVRLRTVVWPEGAAGTVLIFSGRTEYAEKYGPAA
EALRRRGFASATLDWRGQGLSDRSLRDPLVGHVDDFASYQQDVTAFVAALRAQGLPEPFH
LLAHSMGGCIGLRALHEGLPVRAACFSAPMWGIRVHAALRIVAAALGALARATGLGHRYV
PGTGTRSYVATAAFDTNVLTRDPEMFAWMQEQLVQAPELGLAGPSLDWLRAAFEETARLK
RLPAPDLPALCIVGSAEKVVDLEEIQRRMEGWGRGELQIVPGAEHEVMMDRPEVRDAFFD
AAAALFRASADPDAVRS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggcgcaccttttcacgccgccctcgcccgcggaccggccagagcgcatgcggac
tggatccgcaccggcgacggtgtgcggctgcgcaccgtggtctggcccgagggggcggcg
ggaaccgtcctcatcttctcgggccgcaccgaatatgccgagaaatacggccccgcggcc
gaggcgctgcgccggcgcggctttgcctcagccaccctcgactggcgcggacaggggctg
tcggaccggtcgctccgcgatccgctcgtgggccatgtcgacgatttcgcctcctatcag
caggatgtgacggccttcgtcgcggcgctgcgcgcgcaggggctgcccgagcccttccat
cttctggcccattccatgggcggctgcatcgggctccgcgcgctgcacgaggggctgccc
gtgcgcgccgcctgcttctcggcgccgatgtggggcatccgcgtccatgccgcgctgcgg
atcgtagcggcggcactcggggcgctcgcccgcgcgacggggctcgggcaccgctatgtc
cccggcaccggcacgcgcagctatgtcgccaccgccgccttcgacacgaacgtcctcacc
cgcgacccggagatgttcgcctggatgcaggagcagctggtgcaggcgccggaactgggt
cttgccggcccgagcctcgactggctgcgcgcggccttcgaggagacggcgcggctgaag
cggctgcccgcgccggatctgcccgcgctctgcatcgtgggctcggccgagaaggtggtc
gatctcgaggagatccagcgccggatggagggctggggccggggcgaactgcagatcgtg
cccggggccgagcacgaggtgatgatggaccgccccgaggtgcgcgacgccttcttcgac
gccgccgcggcgctgttccgggcgagcgcggacccggacgccgtcagatcctga

DBGET integrated database retrieval system