KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2418Help
Entry
RSP_2418          CDS       T00284                                 

Gene name
pldB
Definition
putative Esterase/lipase/thioesterase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rsp00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1050462..1051415)
Genome map
AA seq 317 aa AA seqDB search
MSGAPFHAALARGPARAHADWIRTGDGVRLRTVVWPEGAAGTVLIFSGRTEYAEKYGPAA
EALRRRGFASATLDWRGQGLSDRSLRDPLVGHVDDFASYQQDVTAFVAALRAQGLPEPFH
LLAHSMGGCIGLRALHEGLPVRAACFSAPMWGIRVHAALRIVAAALGALARATGLGHRYV
PGTGTRSYVATAAFDTNVLTRDPEMFAWMQEQLVQAPELGLAGPSLDWLRAAFEETARLK
RLPAPDLPALCIVGSAEKVVDLEEIQRRMEGWGRGELQIVPGAEHEVMMDRPEVRDAFFD
AAAALFRASADPDAVRS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggcgcaccttttcacgccgccctcgcccgcggaccggccagagcgcatgcggac
tggatccgcaccggcgacggtgtgcggctgcgcaccgtggtctggcccgagggggcggcg
ggaaccgtcctcatcttctcgggccgcaccgaatatgccgagaaatacggccccgcggcc
gaggcgctgcgccggcgcggctttgcctcagccaccctcgactggcgcggacaggggctg
tcggaccggtcgctccgcgatccgctcgtgggccatgtcgacgatttcgcctcctatcag
caggatgtgacggccttcgtcgcggcgctgcgcgcgcaggggctgcccgagcccttccat
cttctggcccattccatgggcggctgcatcgggctccgcgcgctgcacgaggggctgccc
gtgcgcgccgcctgcttctcggcgccgatgtggggcatccgcgtccatgccgcgctgcgg
atcgtagcggcggcactcggggcgctcgcccgcgcgacggggctcgggcaccgctatgtc
cccggcaccggcacgcgcagctatgtcgccaccgccgccttcgacacgaacgtcctcacc
cgcgacccggagatgttcgcctggatgcaggagcagctggtgcaggcgccggaactgggt
cttgccggcccgagcctcgactggctgcgcgcggccttcgaggagacggcgcggctgaag
cggctgcccgcgccggatctgcccgcgctctgcatcgtgggctcggccgagaaggtggtc
gatctcgaggagatccagcgccggatggagggctggggccggggcgaactgcagatcgtg
cccggggccgagcacgaggtgatgatggaccgccccgaggtgcgcgacgccttcttcgac
gccgccgcggcgctgttccgggcgagcgcggacccggacgccgtcagatcctga

DBGET integrated database retrieval system