KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2448Help
Entry
RSP_2448          CDS       T00284                                 

Gene name
glgB1
Definition
1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RSP_2448 (glgB1)
Enzymes [BR:rsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RSP_2448 (glgB1)
Exosome [BR:rsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSP_2448 (glgB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1084026..1086212
Genome map
AA seq 728 aa AA seqDB search
MNVTSKPGELVPESDVAAIMRGTHGDPFRVLGMHGGGGAPLSVRVFAPQAAEVAVLGQGG
EVLAPLERIGAEGFFAGTVPGEEKFPYRLRFVSGPHEWEADDPYRFPEVLGELDEYLLGE
GRHYQLYTRLGAHPAEIEGVQGVSFAVWAPNARRVSVVGAFNAWDGRRHPMRKRIGVGVW
ELFVPGLHTGDLYKYELLGPSGERLPLKSDPLSFAQEAPPATASVVHGLPEAEWHDAGWM
QERESRQRRDAPISIYEVHAGSWRQGLDYDALAEELSAYVREMGFTHVEFLPISEHPFTG
SWGYQPIGLFAPTARFGPPEGFARLVDRLHRDGIGVILDWVPAHFPSDAHGLANFDGTHL
YDHADPRQGFHRDWNTQIYNFGRQEVANFLQASALFWLDRYHVDALRVDAVASMLYLDYS
RNAGEWVPNRHGGRENLEAIDFLRGVNERVRLDHPGCITIAEESTAFPQVSRPVEDGGLG
FGFKWNMGWMHDTLGYFRRDPIHRKHHQNDLTFGMVYAYSEDFVLPLSHDEVVHGKGSLI
GQMAGDRWQKFANLRAYFGFMWAHPGKKLLFMGGEFAQEREWNHDASLDWHLLDDPSHAG
MKRLVADLNREYRKRPALHRMDCDPEGFEWIDAGDSENSVLSFLRKAPGEKPVLAVCNLT
PVVRSDYRIGVPEGGEWREILNSDAAIYGGSDVGNPGGLQAEEFSWHGRPASLRLTLPPL
ATIFVTPA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgacatcgaagcccggggagctcgtccccgaaagcgacgtggccgccatcatg
cgcggaacgcacggagatcccttccgcgtgctgggcatgcacggaggcggcggcgcgccg
ctctccgtccgggtcttcgccccgcaggccgcggaggttgcggtgctggggcaggggggc
gaggtgctcgcccctctcgaacgcatcggcgccgagggcttcttcgcgggcacggtgccg
ggcgaggagaaattcccctaccgcctccgcttcgtctcgggaccgcacgagtgggaggcg
gacgatccctaccgcttccccgaggtgctgggcgagctcgacgaatatcttctcggcgag
gggcggcactatcagctctacacccggctcggcgcgcatccggccgagatcgagggcgtg
cagggggtgagcttcgctgtctgggcgccgaatgcccgccgcgtctcggtggtgggcgcc
tttaacgcctgggacgggcgccgccatccgatgcgcaagcgcatcggcgtgggtgtgtgg
gagctgttcgttcccggcctccataccggagatctctacaaatacgagctgctcgggcct
tcgggcgagcggttgccgctcaagtccgatccgctctccttcgcgcaggaggcgccgccg
gccacggcttcggtggtccatgggctgcccgaggccgagtggcacgatgcgggctggatg
caggagcgcgagagccgccagcgccgcgatgcgccgatctcgatctacgaggtccatgcg
ggctcgtggcggcaggggctcgattacgacgcgctggccgaggaactgtcggcctatgtg
cgcgagatgggcttcacccatgtggaattcctgccgatcagcgaacatcccttcaccggc
tcttggggctatcagcccatcgggctcttcgcccccaccgcgcgcttcggcccgcccgag
ggcttcgcgcggctggtggaccggctccaccgcgacgggatcggcgtcatcctcgactgg
gtaccggcgcacttcccgtcggacgcccatgggctggccaacttcgacgggacccatctc
tatgaccatgccgacccgcggcagggcttccaccgcgactggaacacccagatctacaac
ttcggccgacaggaagtggcgaacttcctgcaggcttcggcgctcttctggctcgaccgc
taccatgtcgatgcgctgcgcgtggatgcggttgcctcgatgctctacctcgactattcg
cggaatgccggcgaatgggtgccgaaccgccacggcgggcgcgagaacctcgaggcgatc
gatttcctgcgcggcgtgaacgagcgcgtccggctcgaccatccgggctgcatcaccatc
gccgaggaatcgacggccttcccgcaggtgagccgcccggtcgaggacggcgggctcggc
ttcggcttcaagtggaacatgggctggatgcacgacacgctgggctacttccggcgcgac
ccgatccaccgcaagcaccaccagaacgacctgaccttcggcatggtctatgcctattcc
gaggatttcgtcctgcccctcagccatgacgaggtggtgcacggcaagggctcgctcatc
gggcagatggcgggcgaccgctggcagaagttcgcgaaccttagggcctatttcggcttc
atgtgggcgcatccgggcaagaagcttctcttcatgggcggcgagttcgcgcaggagcgc
gagtggaaccacgatgcctctctcgactggcacctgctcgacgatccgtcccacgccggg
atgaagcgcctcgtggccgacctgaaccgcgaatatcgcaagcgccccgcgctgcaccgg
atggattgcgatcccgaagggttcgagtggatcgacgccggcgacagcgagaacagcgtg
ctgagcttcctgcgcaaggcgcccggcgaaaagccggtgctggcggtctgcaacctcacg
ccggtggtgcggtcggattaccggatcggggtgcccgagggcggcgagtggcgcgagatc
ctcaactccgacgccgcgatctacggcggctcggacgtgggcaatcccggcgggcttcag
gccgaggagttctcctggcacggacggccggcctcgctgcgcctgacgctgccgccgctt
gcgacgatcttcgtgacgcctgcatga

DBGET integrated database retrieval system