KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2451Help
Entry
RSP_2451          CDS       T00284                                 

Definition
putative 4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RSP_2451
Enzymes [BR:rsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RSP_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1090047..1091864
Genome map
AA seq 605 aa AA seqDB search
MSRTIEDRAAEFAIQPSYHALGGEFVRAPVETLREMLGAFGISLDGPPPDRAPPEMRAPD
GYRCFLPEGEMRRWGIAAQLYQLRSERNWGIGDFADLCDLARIGGAAGADFIGLNPLHAL
FLANPAHTSPFSPSNRRFLNPLYIAVDRVPGYRPEFAPEGLGQLRAPDLVDYPAVAAAKL
GALRRLWREGPDDAMGFMRFCAEGGELLRRHALFEAISGQMVADGYGAGWLGWPVEFHDA
EGQAVIDFADARGDEVGFHLWLQWIADRQLEEARDACRAAGMKIGLYLDFAVGEVPDGSS
TWSDPSLAVPGLRIGASPDWFNAQGQDWGLAPLSPVKLADLRAAPFGALMQDATRRAGAL
RIDHAMGVWQLFLIPDGMGAPQGTYVRYPIEDMLRALAEASCRNRTIVIGEDLGNVPDGF
RELMARMNILSYRILLFERHDHGYIAPEHYPREALVCLSTHDLPTFRGWWRGDDVAIRRD
FRLISDEAARQQGDFRWTERRQLLEDLARAGLMAWDEIDRIGPDDPPEALVVAVHRHLAR
APSRLFAVRIEDMAGEVAPVNVPSTVDEHPNWRRRLGVPLEALGETALFRGIAGALEAER
PREPS
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgagccggaccatcgaagacagggcggccgagttcgccatccagcccagctatcacgcg
ctcggcggcgaattcgtccgcgcgccggtcgagacgctgcgcgaaatgctcggcgccttc
ggcatctcgctggacggaccgccgcccgaccgggcgccgcccgagatgcgggcgcccgac
ggctaccgctgcttcctgcccgagggcgagatgcgccgctggggcatcgccgcgcaactc
taccagctgaggtccgagcgcaactggggcatcggcgacttcgccgatctctgcgatctg
gcgcggatcggaggcgccgcgggggccgatttcatcggcctcaacccgctccacgccctg
tttctggccaatcctgcccacaccagccccttctcgccctcgaaccggcgcttcctgaac
ccgctctatatcgcggtcgaccgcgtgccgggctacaggcccgagttcgcgcccgaaggg
ctgggtcagctccgcgcgccggatctcgtcgattatccggcggtggccgcagccaagctc
ggcgcgctgcgccgtctgtggcgcgaggggccggacgatgcgatgggcttcatgcgcttc
tgcgccgagggcggcgagctcctgcgtcgccacgcgctcttcgaggcgatctcgggccag
atggtggcggacggctacggcgcgggctggctcggctggccggtggagttccacgatgcc
gagggccaggccgtcatcgacttcgccgacgcgcggggcgacgaggtgggcttccacctc
tggctgcagtggatcgccgaccggcagctcgaagaggcgcgcgatgcctgccgcgccgcc
gggatgaagatcgggctctatctcgacttcgccgtgggcgaggtgccggacggctcgagc
acctggtcggacccgagccttgccgtgccgggtctccggatcggcgcctcgcccgactgg
ttcaacgcgcaggggcaggactggggtctggcacccctctctccggtgaagctcgccgat
ctgcgagccgcgcccttcggggcgctgatgcaggatgccacgcgccgcgccggcgcgctg
cggatcgaccatgcgatgggcgtctggcagctcttcctcatccccgacggaatgggcgca
ccgcagggcacctatgtgcgctatccgatcgaggacatgctgcgcgcgctggccgaagcc
tcgtgccgcaaccgcaccatcgtgatcggcgaagacttgggcaacgtgcccgacggcttc
cgcgagctgatggcgcggatgaacatcctctcctaccgcatcctgctcttcgagcggcac
gaccacggctatatcgcgccagagcattatccgcgtgaggcgctcgtgtgcctctccacc
cacgacctgcccaccttccgcggctggtggcggggcgacgatgtggcgatccggcgcgac
ttccgcctgatctcggacgaggcagcccgccagcagggcgacttccgctggaccgagcgg
cgccagctgctcgaggatctggcgcgggcgggcctgatggcgtgggacgagatcgaccgg
atcggccccgacgatccgcccgaggcgctggtcgtggcggtgcaccgccatctcgcccgc
gcgccctcgcgcctcttcgcggtccggatcgaggacatggcgggcgaggtggccccggtg
aacgtgccctcgaccgtggacgaacatcccaactggcggcgcaggctcggcgtgccgctg
gaggctctgggcgagaccgcactgttccgcggcatcgccggagcccttgaagccgagcga
ccaagggagccctcatga

DBGET integrated database retrieval system