KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2557Help
Entry
RSP_2557          CDS       T00284                                 

Gene name
asnB
Definition
putative asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RSP_2557 (asnB)
Enzymes [BR:rsp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RSP_2557 (asnB)
Peptidases [BR:rsp01002]
 Cysteine Peptidases
  Family C44
   RSP_2557 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1199557..1201437
Genome map
AA seq 626 aa AA seqDB search
MSALAAFVTLGGDPGEAQSRVLSMLSAMPTRGTELRVRALTAGVALGHGRPAGRGGLGPW
RLRPGGPVLTGTVRLDNGPELRRALGLAEASDAETVLAVYDRWGLDLPLHLDGDFALALW
DPVAARLIGLRDRFGVRPFLYRATPQAVAVASGIEALVAAFPACEPALDEVWIAEYLSGQ
PTCARRTVYRGISRLEPAHMLLVEKGRTEVRRYWQLEVAPRRRADPPEALLELLDRSVTA
RMQGGPVGSMLSGGLDSGTVSMLASRRSEGPLPVISMKFDDHPEIDESEWIAKIHAAGRF
RPVWIDGRDAHGGDVAELLAEQGGPFFAPNLATSRWLYRRAAEAGVEILLDGHGGDEVIS
FGVARLTELASEAQWRTLWQSTAAVSDLFGGSRREFFLNSMAQGAQSRWLRAMARRLNVG
AKRDPRAWRQALHPALVARTGLVQRVQEAAGARKRGATDDIRQHVATLTAPRYPTTLEVL
DRAATLCGIEPRYPFLERRLIEHCVAQPAAAKFHDGMTRALLRDAVRGLLPDEVRLRTSK
TNFTPNVRARMLTSWGDNLNRIAGCNPGRIGDYVDLAVIREGIQRLRAGEPDQPALLQTM
RAVVLDEWLRGGSSALAPRLDRRTPA
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcttgcagccttcgtcacgctgggcggagatccgggcgaggcccagagccgc
gtcctgtcgatgctgtccgccatgcccacgcgcggcacggagctccgggtgcgcgcgctg
accgcgggcgtggcgctggggcacgggcggcccgcggggcgcggcggcctcgggccctgg
cggttgcggccgggcggcccggtcctgaccggcaccgtgcggctcgacaacggtcccgag
ctgcgccgcgcgctggggctggccgaggcctccgacgccgagacggtgctcgcggtctat
gaccgctgggggctcgatctgccgctccatctcgacggcgacttcgcgctggccctgtgg
gatcctgtggccgcgcgcctcatcgggctgcgcgaccggttcggcgtccgcccgttcctc
taccgcgcgacgccgcaggcggtggcggttgcctccggcatcgaggcgctggtggcggcc
tttcccgcctgcgagcccgccctcgacgaggtctggatcgcggaatatctatctggccag
cccacctgtgcccgccggaccgtctatcgcggcatctcccggctcgagcccgcccacatg
ctgctggtcgagaagggccggaccgaggtccgtcgctactggcagctggaggtggcgccg
cggcgccgcgccgatccgcccgaagcgctgctcgaactgctcgaccgctccgtgacggcg
cggatgcagggcggcccggtgggctcgatgctgagcggagggctcgattccggcacggtc
tcgatgctggcttcacgccggtcggaggggccgctgccggtcatctcgatgaagttcgac
gatcatccggagatcgacgagagcgagtggatcgcgaagatccatgctgccggccggttc
cgtccggtctggatcgacggtcgtgacgcccatggtggcgatgtggccgagctgctggcc
gagcagggggggcccttcttcgcgcccaatctggccacctcgcgctggctctaccggcgc
gcggcggaggccggcgtcgagattctgctcgacggccatggcggcgacgaggtgatctcc
ttcggcgtggcccggctgaccgaactggcctccgaggcccaatggcggaccctctggcag
tcgacggccgccgtgtcggacctgttcggcggatcgcggcgggagttcttcctgaattcg
atggcgcagggcgcgcagtcccgctggctgcgcgccatggcgcggcggctgaatgtgggc
gcaaagcgcgatccccgggcgtggcggcaggcgctccatccggcgctggtggcgcggacg
ggcctcgtccagcgcgtgcaggaggcggccggcgcgcgcaagcggggggccaccgacgac
atccgccagcatgtggcgaccctgaccgccccgcgctatccgaccacgctcgaagtgctc
gaccgcgcagccacgctctgcgggatcgagccgcgctatccgttcctcgagcggcggctg
atcgaacattgcgtggcccagcccgccgcggcgaagttccacgatggcatgacacgcgcc
ctcctgcgcgatgcggtgcgggggcttctgcccgacgaggtgcggctgcgcaccagcaag
accaatttcacccccaacgtccgcgcgcgcatgctgacgagctggggcgacaatctcaac
cggatcgccggctgcaatcccggccggatcggcgactatgtcgatctggccgtcatccgc
gagggcatccagcggctgcgggcgggcgagcccgaccagccggccctcctccagaccatg
cgggcggtcgtgctcgacgaatggctgcgcggcggatcgtccgcgctggccccccgcctc
gacagaaggacccccgcatga

DBGET integrated database retrieval system