KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2565Help
Entry
RSP_2565          CDS       T00284                                 

Gene name
ugpG
Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rsp00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rsp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rsp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rsp00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1210491..1211429)
Genome map
AA seq 312 aa AA seqDB search
MSSQKVTTAIFPIAGMGTRFLPATKSIPKEILTLVDKPLIQYAVEEAREAGIEDFIFVTS
RGKGALEDFFDVNQTLERALRAAGKTELLATLEATNIDSGHVTYVRQHEALGLGHAVWCA
RRLVGDEPFAVILPDDMVVADKPCLAQMIEAHEEVGGSIIATMEVPAEKASSYGVLDIEE
RQGALIRPRGIVEKPKAGTAPSNMAVIGRYILGPRVMQHLDRRTVGAGGEIQLTDAIAHE
LATHPGSVHGFRFQGERFDCGSKAGFLQATVALALEREDLRGEFSTFLRAIAEQHGLGAP
SAAPLRSVAAAS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccagaaggtcaccactgccattttccccatcgcaggcatggggacgcggttc
ctgcccgcgaccaagtcgatcccgaaggaaattctcacgctcgtcgacaagccgctgatc
cagtatgcggtcgaggaagcccgcgaggccggcatcgaggacttcatcttcgtcacctcc
cgcggcaagggggcgctcgaggacttcttcgacgtgaaccagacgctggagcgggccctg
cgcgcggcgggcaagaccgagcttctggcaacgctcgaggccaccaatatcgacagcggc
catgtgacctacgtccgccagcacgaggcgctgggcctcggccatgccgtctggtgcgcg
cgccgcctcgtgggcgacgagcccttcgcggtgatcctgcccgacgacatggtggtcgcc
gacaagccctgcctcgcgcagatgatcgaggcccatgaagaggtcggcggcagcatcatc
gccacgatggaagtgccggcggaaaaggcgtcctcctacggcgtcctcgacatcgaagag
cgtcagggcgcgctgatccgtccgcgtggcatcgtcgagaaaccgaaggccggcaccgcg
ccttcgaacatggcggtcatcggccgctatatcctcgggccgcgcgtcatgcagcatctc
gaccggcgcaccgtcggagcggggggcgagatccagctgaccgacgccatcgcgcacgag
ctggccacccatccgggctcggtccacggcttccgcttccagggcgagcggttcgactgc
ggctcgaaggcgggcttccttcaggccaccgtcgcgctggcgctggagcgcgaggatctg
cgcggggaattctcgaccttcctgcgggcgatcgccgagcagcacggtctcggagccccg
agcgccgcgccgctgcgcagcgtggcggccgcgagctga

DBGET integrated database retrieval system