KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2632Help
Entry
RSP_2632          CDS       T00284                                 

Gene name
argI
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rsp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1271593..1272519)
Genome map
AA seq 308 aa AA seqDB search
MRKTCILIGAPIDSGQRRPGCLMGPAAYRVAGLGRALADLGHAVEDRGDVALGPLPEMTP
PEGPVHDLPETIGWTAALKTAVEEALGDGFPIVMGGDHSLALGTVAGAAAHAAAVGRPLF
LLWLDAHSDFHTLQTTTSGNLHGVPVAYAAGRDGFDGFPPFPAPLPPERICLFGIRSVDP
EEHAALLLHDVSIIDMRVIDEFGICAPMREFLEKVRAANGMLHVSLDVDFVDPAHAPAVG
TTVPGGATVREAHLVMELLHESGLVTSLDLVELNPFLDERGRTARLMVELAASIMGRKVF
DRPTRSFG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagacctgcatcctgatcggcgcgccgatcgacagcggccagcgccgcccgggc
tgcctgatggggcctgcggcctatcgcgtggcgggcctcggccgcgcgctcgccgatctc
ggtcacgcggtcgaggatcgcggcgacgtggccctcgggcccctgcccgagatgacgccg
ccggagggtccggttcacgacctgcccgagacgatcggctggaccgcggcgctgaagacc
gccgtcgaagaggccttgggcgacggctttcccatcgtgatgggcggggatcattcgctt
gccctcggcaccgtggccggggccgcggcccatgcggcggcggtggggcggccgctgttc
ctcctctggctcgacgcccattccgacttccacacgctccagaccaccacctccggcaat
ctccacggcgtgcccgtggcctatgccgccgggcgcgacgggttcgacggcttcccgccc
ttccccgcgccgctgccgcccgagcggatctgcctcttcggcatccgctcggtcgatccc
gaggaacatgcggcgctcctcctccacgatgtctcgatcatcgacatgcgggtgatcgac
gagttcggcatctgcgcgccgatgcgcgagttcctcgagaaggtgcgcgcggccaacggg
atgctgcacgtctcgctcgatgtggatttcgtcgatcccgcccatgcgcccgcggtgggc
accaccgttccgggcggcgccacggtgcgcgaggcgcatctggtgatggagcttctgcac
gagagcggtctcgtgacctcgctcgatctggtggagctgaacccgttcctcgacgagcgc
ggacgcaccgcgcggctgatggtcgaactcgccgcctcgatcatggggcgcaaggtcttc
gacaggcccacgcgcagcttcggctga

DBGET integrated database retrieval system