KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2662Help
Entry
RSP_2662          CDS       T00284                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rsp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1303982..1305463)
Genome map
AA seq 493 aa AA seqDB search
MNHILAIDQGTTSSRAMVFDEALTLKSVAQEEFPQIYPRPGWVEHDPSDLWSSVAATARA
AVERAEIDGSLAAIGITNQRETVVVWERASGHPIHNAIVWQDRRTADLCHALAEAGHEPT
ITERTGLLLDPYFSATKLKWLLDHVEGARARARRGELLFGTVDSYLIWKLTGGRAHVTDA
TNAARTMLFDIGRGIWDPEICGLLDIPMEMLPEVRDCAAPFGMTRADLFGREIPILGVAG
DQQAATCGQACFRPGMMKSTYGTGCFALLNTGEERVTSRARLLTTIAYQLGGKRTYALEG
SIFIAGAVVQWLRDGLKIIREAGETQGLALSSDAAQDLVIVPAFTGLGAPWWKPESRGAV
FGLTRNSGPAEFARAALESVGYQTRDLLEAMRADWAAGAEGVLRVDGGMAASDWSLQFLA
DIIGAPVDRPVVRETTALGVAWLAGMQAGLCPGPEEFAADWALERRFEPQMEASVREAKY
DRWGRAVRAVMAV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacatcctcgccatcgatcagggcaccacctcgtcgcgcgcgatggtcttcgac
gaggccctcacgctgaagtcggtcgcgcaggaggaattcccgcagatctacccgcgcccg
ggctgggtcgagcacgacccctcggacctctggtcgagcgtcgccgccaccgcgcgggcg
gcggtcgagcgggccgagatcgacggcagcctcgcggcgatcgggatcaccaaccagcgc
gaaaccgtcgtcgtctgggagcgtgcctcggggcatccgatccacaatgccatcgtctgg
caggaccggcgcacggccgatctctgccatgccctggccgaggcagggcacgagcccacg
atcaccgagcggacgggcctgctgctcgatccctatttctcggccaccaagctcaaatgg
ctgctcgatcatgtggagggcgcccgcgcccgcgcgcggcggggcgagctgctgttcgga
acggtggacagctacctgatctggaagctcaccggcgggcgcgcgcatgtgaccgacgcc
accaatgccgcgcgcaccatgctcttcgacatcggccgcggcatctgggacccggagatt
tgcggccttctcgacattccgatggagatgctgcccgaggtccgggattgcgcggccccc
ttcggcatgacgcgcgcggatctcttcgggcgcgagatcccgatcctcggcgtggcgggc
gaccagcaggccgccacctgcggccaggcctgcttccggcccggcatgatgaaatcgacc
tacggcaccggctgcttcgcgctgctgaacaccggcgaggagcgggtgacgagccgcgcg
cggctgctgaccaccatcgcctatcagctcggcggcaagcgcacctacgcgctggagggc
tcgatcttcatagcgggcgccgtggtgcaatggctgcgcgacgggctgaagatcatccgt
gaggcgggcgagacgcagggcctcgccctctcctcggacgcggcgcaggatctggtgatc
gtgcccgccttcaccggcctcggcgcgccctggtggaagcccgagagccgcggcgcggtc
ttcggactcacccgcaactcgggccctgcggaattcgcccgcgccgcgctcgaaagcgtg
ggctaccagacgcgcgacctgctcgaggcgatgcgggcggactgggcggcgggggccgag
ggcgtgctgcgggtcgatggcgggatggcggcctcggactggtcgttgcagtttctggcc
gacatcatcggcgcgccggtcgaccggccggtggtgcgcgagacgacggcgctcggtgtc
gcgtggctcgcggggatgcaggcggggctctgcccggggccggaggagttcgcggccgac
tgggcgctggagcgacggttcgagccgcaaatggaggcgtcggtgcgcgaggcgaaatac
gaccgttggggtcgggccgtgcgcgcggtgatggcggtatga

DBGET integrated database retrieval system