KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2875Help
Entry
RSP_2875          CDS       T00284                                 

Gene name
glk
Definition
putative glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSP_2875 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_2875 (glk)
   00052 Galactose metabolism
    RSP_2875 (glk)
   00500 Starch and sucrose metabolism
    RSP_2875 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    RSP_2875 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSP_2875 (glk)
   00524 Butirosin and neomycin biosynthesis
    RSP_2875 (glk)
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RSP_2875 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1544648..1545601
Genome map
AA seq 317 aa AA seqDB search
MADAPLCLVADIGGTNTRVALAEGSRLRPETTRRFRNADYPALAPVLRDFLSVAGSPEID
GTCVAAAGPVRDGVALLTNLAWTVDGAELQRATGAPRVAVLNDLQAQGHALGHLDPANLR
VLIPGPTPRRGGPMLVVGVGTGFNAAPVHDVAGLRLVAASECGHAGMPVRTARDLRLAEF
VQTAHGFAGVEDVLSGRGLERLYAFTAAEAGLEDRKSAAEIMAAIAEPGPARAAAELFAR
LLGAEAGNLALIHLPFGGLYLCGGVARAFAAHLGPMGFAENFRDKGRFSAFMDDFPVCIV
EDDYAALTGCAAYLATL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcgcccctttgcctcgtcgccgacatcggtggcacgaacacccgcgtggcg
ctggcggagggatcccggctgcggcccgaaacgacgcgccgcttccggaatgccgattat
cctgctctggcgccggtcctgcgcgacttcctctccgtcgccggcagccccgagatcgac
ggcacctgcgtggccgccgcgggcccggtccgggacggggtggcccttctcacgaacctc
gcctggaccgtcgacggcgccgaactgcagcgcgcgaccggcgcgccgcgcgtggcggtg
ctgaacgatcttcaggcgcagggccatgcgctgggccatctggatccggccaatctgcgc
gtcctgatcccggggcctactccccgccgcgggggcccgatgctcgtcgtgggcgtcggc
accggcttcaacgcggcgcccgtccacgatgtcgcgggcctgcgcctggtggcggcctcc
gagtgcggccatgccgggatgcccgtccgcaccgcgcgcgacctccggctcgcggaattc
gtccagacggcccacggtttcgccggcgtcgaggatgtgctgtcgggccgcggtctcgag
cggctctatgccttcaccgccgctgaggccggcctcgaggaccgcaagtcggcggccgag
atcatggcggccatcgccgaacccggcccggcgcgcgccgcggccgagctcttcgcccgg
ctcctcggcgccgaggcgggcaatctcgccctgatccacctgcccttcggcggcctctat
ctctgcggcggcgtggcccgggccttcgccgcccatctgggcccgatgggctttgccgag
aacttccgcgacaagggccgcttctcggccttcatggacgatttcccggtctgcatcgtc
gaggacgattacgcggccctcaccggctgcgcagcctacctcgccaccctctga

DBGET integrated database retrieval system