KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2909Help
Entry
RSP_2909          CDS       T00284                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RSP_2909
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     RSP_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1587246..1588211)
Genome map
AA seq 321 aa AA seqDB search
MALEDAKNEVDVAFGGRGPRGYAYENAFAGATSFLRRRYTKDLTGVDLAITGVAFDQAVT
NRTGTRFGPRAIREASTLQPYDRPFGWGFDPLEELTVVDYGDLAFDYARTAEFPARLTAH
VAGILAAGAGALTLGGDHSITLPILRAHAAVFGPLSVVQFDAHSDLWVDDDPGRIDHGTF
MYKAVKEGLVDPARSVQVGIRTDTPDWLGMNVIDARTAHEQGPAAVAARVHAIVGHHPTY
LTFDVDALDPAFAPGTGTPVWGGLASWQAAAILRDLAGLNLVGGDVVEVSPPYDPSGITA
VAGAHVAYELICLYGWRRRKE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgaggatgcgaagaacgaggtggacgtcgccttcgggggccgcggcccccgc
ggctacgcctacgagaacgcctttgccggggccacgagcttcctgcgccgccgctacacg
aaggacctgacgggggtcgatctggcgatcaccggcgtggccttcgatcaggcggtgacg
aatcgcaccggcacccgcttcggaccccgcgcgatccgcgaagcctcgacgcttcagccc
tacgaccggccgttcggctggggcttcgatccgctggaagagctgacggtggtcgattac
ggcgacctcgccttcgactatgcccgcacggccgagtttcccgcccgcctcaccgcccat
gtcgcgggcatcctcgcggcgggcgcgggcgcgctcacgctcggcggcgatcattcgatc
accctgccgatcctgcgcgcccatgcggcggtgttcgggccgctttcggtggtgcagttc
gatgcccattccgatctctgggtcgatgacgatccgggccggatcgaccatggcaccttc
atgtacaaggcggtgaaggagggcctcgtcgatccggcccggtccgtgcaggtgggcatc
cgcaccgacacgcccgactggctgggcatgaacgtgatcgacgcgcggacggcgcacgaa
cagggcccggccgcggtcgcggcgcgggtgcatgcgatcgtgggccaccatcccacctac
ctcaccttcgacgtcgacgcgctcgacccggccttcgcgccgggcaccggcacgccggtc
tggggcggcctcgcctcctggcaggccgcggcgatcctccgcgatctcgcgggcctgaac
ctcgtggggggcgatgtggtcgaggtctcgcctccctacgatccctccggcattacggcc
gtcgcgggcgcccatgtggcttacgagttgatctgtctctacggttggagaaggcgcaag
gaatga

DBGET integrated database retrieval system