KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2919Help
Entry
RSP_2919          CDS       T00284                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00230  Purine metabolism
rsp01100  Metabolic pathways
Module
rsp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RSP_2919
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RSP_2919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 3720658
NCBI-ProteinID: YP_352980
UniProt: Q3J2A5
Position
1:complement(1596590..1597225)
Genome map
AA seq 211 aa AA seqDB search
MARRGLLLILSSPSGAGKSTLSKRLTAWDPSIRFSVSATTRAPRPGEVDGRDYYFRTRDE
FIAAVEAGEMLEHAEVFGNFYGSPKAPVEKALEQGHDTLFDIDWQGGQQIRNSSLGRDVV
SIFVLPPSIGELDRRLRSRAQDSEEVIATRMARSKDEISHWAEYDYVLVNRDLDLAEEQL
KMILSAERLRRDRQPDLMDFVRGLNGEFETR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
ttggcccgtcgtggacttcttctgatcctctcctcgccgtcgggcgcgggcaaatcgacc
ctctcgaagcggctgaccgcctgggatccctcgatccgcttctcggtctcggccaccacc
cgcgcgccgcggccgggcgaggtggacgggcgcgattactacttccgcacccgcgacgaa
ttcatcgccgccgtcgaggcgggcgagatgctcgaacatgccgaggtcttcggcaatttc
tacggctcgcccaaggctccggtcgagaaggcgctggagcagggccacgacaccttgttc
gacatcgactggcagggcggccagcagatccgcaactcctcgctcggccgcgacgtggtc
tcgatcttcgtgctgccgccctcgatcggtgagctcgaccgccgcctgcggtcgcgggcg
caggacagcgaggaggtgatcgccacccgcatggcgcgctcgaaggacgagatcagccat
tgggcggaatatgattatgtgctcgtcaatcgcgatctcgaccttgcggaggagcagctg
aaaatgatcctctccgccgagcgtctgcgccgcgaccgccagcccgacctgatggacttc
gtgcgcggcctcaacggggagttcgagacgagatga

DBGET integrated database retrieval system