KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2941Help
Entry
RSP_2941          CDS       T00284                                 

Definition
Putative Glycoside hydrolase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RSP_2941
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RSP_2941
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RSP_2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1620423..1621436)
Genome map
AA seq 337 aa AA seqDB search
MSEAGRTAAIFGCSGPVLTDAERQFFREADPFGFILFARNIDNPAQVFALTQELRSTVGR
DAPIFVDQEGGRVQRLRAPHWREWLPPLEAVERAGDRAARMLWLRYRLIAEDLRAVGIDG
NCAPVADIRTAATHPFLANRCLADEAARVAELARAAAEAHLAGGVLPVMKHLPGHGRAAA
DTHHDLPTVTASREELAATDFAAFRALADLPLAMTGHVVFSAYDAQPATLSGPMVGVIRD
EIGFSGLLMTDDLSMQALSGGIGARAGAAIAAGCDLALHCNGELAEMEAVAAAAGAMGPE
ALERAAAALARRRPPEPVDSRALEAEHSVLLGGHGHG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggctggccggacggccgcgattttcggctgctccggcccggtcctcacggat
gccgagcggcagttcttccgcgaggccgaccccttcggcttcatcctcttcgcgcgcaac
atcgacaaccccgcgcaagtctttgccctgacgcaggaactgcgttccaccgtggggcgc
gacgcgcccatcttcgtcgatcaggaaggcggccgcgtccagcgtctccgcgcgccgcac
tggcgcgagtggctgccgcccctcgaggcggtggagcgcgccggggaccgggcggcccgg
atgctctggctgcgctaccggctcatcgccgaggacctgcgggcggtgggcatcgacggc
aactgcgcgcccgtggccgacatccgcaccgcggcgacccatccgtttctcgccaaccgc
tgcctcgccgacgaggcggcgcgcgtggcggagcttgcccgcgcggcggccgaggcgcat
ctggcgggcggggtcctgccggtgatgaagcatctgccgggccacggacgggccgcggcc
gacacgcaccacgacctgcccacggtaaccgccagccgcgaggagctggccgccaccgac
ttcgcggccttccgggcgctcgcggatctgcccttggccatgacgggtcatgtggtcttt
tcggcctatgatgcgcagcctgcgaccctctcggggcccatggtcggcgtcatccgcgac
gagatcggcttttcgggcctcctcatgacggacgatctgtcgatgcaggccctctcgggc
gggatcggcgcgcgggcgggggcggccatcgcggccggctgcgatctggcgctccattgc
aacggcgaactggccgagatggaggccgtggccgccgccgcgggcgcgatggggcccgag
gcgctggagcgcgccgcagcggcgctggcccgccgcaggccgcccgagccggttgacagc
cgggcgctcgaggccgaacattccgtccttctgggcgggcatggacatggctga

DBGET integrated database retrieval system