KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3246Help
Entry
RSP_3246          CDS       T00284                                 

Definition
(RefSeq) D-stereospecific aminopeptidase
  KO
K01266  
D-aminopeptidase [EC:3.4.11.19]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Brite
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.19  D-stereospecific aminopeptidase
     RSP_3246
Peptidases [BR:rsp01002]
 Mixed Peptidases
  Family P1: DmpA aminopeptidase family
   RSP_3246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:303384..304934
Genome map
AA seq 516 aa AA seqDB search
MTLDLDALDRALDALPNLFRGPGGVAGVVKDGQVVASRAWGYADLTRRRPMETGTRLPIC
SISKQFTCGALLDTLGDTAAYDARVAEFLPQFEGPLPTLRQLCDNQSGLRDYWALTVLQG
AEAAQTFRREDALPLIARMKTGHFPPGTAYSYCNCNFRIVSEILESETGRALRDLYAERI
FGPAGMRTAELTSDTRHPADEVVGYEGSDAVGFFPADNGIFWIGDAGISASLQDMLAYES
WIDATRNDENSIYRRISVPPAYVCGTPASYGFGLSHETVAGVKVTGHGGALRGFRAQRFH
AADERLSVVVIFNHEASAHAAASSLLAAALGHEAPKGARPEGWAGQWLDPESGLLLRVGE
DAEGLTLRFATGPDRLTAGEDGVPRGAGVSLAREGAMLVMNRTSDNLTVRAEPLPVVAVA
DAGEIAGRYHARELEADLVIEARDGGAYAGFEGLLGAGPMERLHPVGPDVWIVTTRRSMD
APAPGDWTLQVRREGGAVTGLRLGCWLARRIDYARV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgatctcgacgcgctcgaccgcgccctcgatgcgctgccgaacctcttccgc
ggacccggcggcgtggccggggtggtcaaggacgggcaggtggtggccagccgcgcctgg
ggctacgcggacctgacccgccgccgcccgatggagacaggcacgcgcctgccgatctgc
tcgatctcgaagcagttcacctgcggcgcgctgctcgacacgctgggcgacaccgccgct
tacgatgcgcgggtggccgagttcctgccgcagttcgaggggccgctgccgacgctccgc
cagctctgcgacaaccagtcgggcctgcgcgactactgggcgctgaccgtactgcagggg
gccgaggccgcccagaccttccggcgcgaggatgcgctgccgctgatcgcgcggatgaag
accgggcatttcccgcccggcaccgcctattcctactgcaactgcaacttccgcatcgtt
tcggagatcctcgagagcgagacgggccgcgcgctgcgcgatctctatgccgagcggatc
ttcgggccggcggggatgcggacggccgagctcacctcggacacgcgccacccggccgat
gaggtggtgggctacgagggcagcgatgcagtgggcttcttcccggccgacaacgggatc
ttctggatcggcgatgccggcatctcggcctcgcttcaggacatgctggcctacgagagc
tggatcgatgccacgcgcaacgatgaaaactcgatctaccgccgcatttcggtgccgccc
gcctatgtctgcggcacgcccgcaagctacggcttcggcctctcgcatgagacggtggcg
ggggtgaaggtcacgggccacggcggcgcgctgcggggcttccgggcgcagcggttccat
gcggccgatgagcggctctcggtcgtggtgatcttcaaccacgaggccagcgcccatgcg
gcggcaagctcgctgctggcggcggctctgggccacgaagcgccgaagggcgcgcgcccg
gagggctgggccggccaatggctcgatcccgagagcgggcttctgctgcgcgtcggggag
gatgccgaggggctgacgctgcgcttcgcgaccggcccggaccggctgaccgcgggcgag
gatggcgtgccgcggggggcgggcgtgagccttgcgcgcgagggcgcgatgctcgtcatg
aaccggacctccgacaatctgaccgtgcgggccgagccgctgcccgtcgtcgccgtggcg
gatgcgggcgagatcgccgggcgctaccatgcgcgcgagctcgaggccgatctcgtgatc
gaggcgcgcgacggcggcgcctatgcgggcttcgaggggcttcttggtgcagggccgatg
gagcggctgcatccggtcgggcccgatgtctggatcgtcacgacgcggcggtcgatggat
gcgcccgcgccgggcgactggaccctgcaggtccggcgcgagggcggggccgtgaccggc
ctccgcctcggctgctggctcgcgcggcgcatcgactacgcccgggtctga

DBGET integrated database retrieval system