KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3252Help
Entry
RSP_3252          CDS       T00284                                 

Definition
(RefSeq) ABC peptide transporter, fused ATPase domains
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp02024  Quorum sensing
Module
rsp_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3252
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    RSP_3252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_29 AAA_25 RsgA_GTPase AAA_22 Mg_chelatase IstB_IS21 TniB AAA_16 ATP-synt_ab AAA AAA_23 Sigma54_activat PRK ABC_ATPase AAA_5 DUF815 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 3721854
NCBI-ProteinID: YP_354762
UniProt: Q3IX73
Position
2:complement(310200..311978)
Genome map
AA seq 592 aa AA seqDB search
MSGAALLSGAASAPDAEALPALTVEGLEVSVRTEAGLRPLVSGLSFTLARGETLAIAGES
GSGKSITSLAIMGLLPPPAVRITGGRVKLGRTELTDLPEGRMRAIRGDRVAMIFQEPMTS
LNPVLTIGTQLAEAIRAHETVSKAEARARALEALRSVRLSQPERRLDQYPHELSGGMRQR
VMIAMALALRPEVLIADEPTTALDVTVQREVLDLLRDLQRELGTAIILITHDMGVVAEMA
DRVIVMRDGRMVEEGPATQIFTEPRAEYTRALLAAVPRMGAGRGRPPVEAEPIARLSDLQ
VRFDLKGGLLGRTQARVHAVEHVSFDIRRGETFALVGESGCGKSTIAKAMVGLVPHEGRI
EIGGDRLGALDAAGRKALRRRVQIVFQDPMAALDPRMRIGDLIAEPLVIHGIGTPEERRA
RVGDLLTRVGLSPAQMERYPHEFSGGQRQRICIARALALRPELIIADESVSALDVSVQAR
VLDLLAALKREFGIALLFISHDMAVVENVSDRVAVMYLGQIVEMGTRDQVFGNPQHPYTR
RLIEAVPVPDPLHQRPPAPRLAGEIPSPVHPVGSGPERVRLTDVGAGHLVAR
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgccgcactcctttccggggcggcctccgccccggacgcagaggccctgccc
gcgctcaccgtggaggggctcgaggtttcggtccgcaccgaagcgggcctgcgcccgctg
gtctcgggcctctccttcacgctcgcccgcggcgagacgctcgccatcgcgggcgagagc
ggttcgggcaagtcgatcacctcgcttgcgatcatgggcctcctgcccccgcccgcggtg
cggatcaccggggggcgcgtcaagctcggccggaccgagctcaccgacttgcccgaggga
cggatgcgcgccatccgcggcgaccgggtggcgatgatctttcaggagccgatgacctcg
ctgaacccggtgctgaccatcggcacgcagctcgccgaggccatccgcgcccatgagacg
gtctcgaaggccgaggcccgcgcccgcgcgctcgaggccctgcggtcggtgcgcctctcg
cagcccgagcggcggctcgaccagtatccgcacgaactttcgggcggcatgcgccagcgg
gtgatgatcgccatggcgctggcgctccgccccgaggtgctcatcgccgacgaacccacc
accgcgctcgacgtgacggtgcagcgcgaggtgctggaccttctgcgcgaccttcagcgc
gagctgggcacggcgatcatcctcatcacccatgacatgggcgtggtggccgagatggcc
gaccgggtgatcgtgatgcgcgacgggcgcatggtcgaggaaggcccggccacgcagatc
ttcaccgaaccgcgggccgagtacacccgcgcgcttctggccgccgtgccgcgcatgggc
gcgggccggggccgcccgccggtggaggccgagcccatcgcgcggctttcggacctgcag
gtgcgcttcgacctgaagggcgggctgctcgggcgcacacaggcgcgcgtccatgccgtc
gaacatgtaagcttcgacatccgccgcggcgagaccttcgcgctcgtgggcgagtcgggc
tgcggaaaatccaccatcgccaaggccatggtcggcctcgtcccgcacgaaggccggatc
gagatcggcggcgacaggctcggagcgctcgacgcggccgggcgcaaggccctgcgccga
cgggtgcagatcgtctttcaggatccgatggcggcgctcgatccccggatgcggatcgga
gacctgatcgccgagccgctggtgatccacggcatcggcacgcccgaggagcgccgcgcc
cgcgtgggcgacctgctcacccgcgtgggcctcagccccgcgcagatggagcgctatccg
cacgaattctcgggcggccagcggcagcggatctgcatcgcccgggcgctcgcgctgcgc
cccgagctcatcatcgccgacgaatccgtctcggctctcgacgtctcggtgcaggcgcgc
gtgctcgatctgctcgcggcactgaagcgcgagttcggcatcgcgctcctgttcatcagc
catgacatggcggtggtcgagaatgtctcggaccgggtggcggtgatgtatctcggccag
atcgtcgagatgggcacccgcgatcaggtcttcggcaacccgcagcatccctacacccgg
cggctgatcgaggcggtgccggtgcccgatccgctgcatcagcgcccgcccgcgccccgg
ctggcgggcgaaatcccgagcccggtccatcccgtcggctcggggcccgagcgggtgcgg
ctcaccgatgtgggcgcgggtcaccttgtcgcacggtga

DBGET integrated database retrieval system