KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3259Help
Entry
RSP_3259          CDS       T00284                                 

Definition
(RefSeq) Transcription antitermination protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANTAR
Motif
Other DBs
NCBI-GeneID: 3721859
NCBI-ProteinID: YP_354767
UniProt: Q3IX68
Position
2:complement(316369..316968)
Genome map
AA seq 199 aa AA seqDB search
MKRGVRHQNLGGARAVILHRPHPVVQALTRQLHAIGLEVGDCWPDLEPQAISADFIFFDA
DMGHDAQFPWKPGESPMPMIALIGSEAPGRIEWSLQAGAHAQLLKPIGDSGAYSALLIAR
AAFDAHRALSAEIADLRRRLDQRQTVVQAVTLLAQRARDESAAYGQLRQMAMAWRVSIEE
AAHRIVASQGGPDDRRDRG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcggcgtccggcaccagaatctcggcggcgcgcgggcggtgatcctgcaccgg
ccgcacccggtcgttcaggcgctgacccgccagcttcacgccatcggcctcgaggtcgga
gactgctggccggacctcgagccgcaggcgatctcggccgatttcatcttcttcgacgcg
gacatggggcacgatgctcagtttccgtggaaacccggcgaaagcccgatgcccatgatc
gcgctgatcgggtcggaggccccggggcgcatcgaatggagcctgcaggccggcgcccat
gcccagcttctgaagcccatcggcgacagcggcgcctattcggcgctgctgatcgcgcgg
gcggccttcgacgcgcaccgcgcgctgtcggccgagatcgcggacctgaggcggcggctc
gatcagcgtcagaccgtcgtgcaggcggtgacgctgctggcgcaacgggccagggacgag
agcgccgcctacggccagctccgccagatggcgatggcctggcgggtgagtatcgaggag
gccgcgcaccgcatcgtcgcgagccagggaggaccggatgaccgacgcgaccgcggctga

DBGET integrated database retrieval system