KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3260Help
Entry
RSP_3260          CDS       T00284                                 

Gene name
amiC
Definition
(RefSeq) amino acid/amide ABC transporter substrate-binding protein, HAAT family
  KO
K01999  
branched-chain amino acid transport system substrate-binding protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
ABC transporters
Quorum sensing
Module
Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RSP_3260 (amiC)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RSP_3260 (amiC)
Transporters [BR:rsp02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    RSP_3260 (amiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:complement(316965..318026)
Genome map
AA seq 353 aa AA seqDB search
MKRRIDLGLLYSRSGSYALISDACRTGALAAVAEVNAGPFDLELVPVERDPGGNIDFYAP
LCEELLAHEGLRHVVGCVTSWSRKEVIPTLEKARGTLWYAVPYEGFEASDHVVYTHACPN
QHLLPLLDWAFPAFGRRAYLTGSNYIWGWEMNRLARERIGAAGGKVLGERYLPIGSLEID
RMIEEIRATAPDFILNSLIGPSSYAFLKAYQALGREDARFRPDRCPVMSCNLTECELPAL
GDAAEGLIAAGPYFRGEGRFGSSHEAAAHAAVMELARLLSGRPGAERLPLSQLLAGSPPG
IVDPQTHHTALPVLISQVSGGRFTVRERLPARPGDPYLTHPAPARPATLRIVS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgacgcatcgaccttggacttctctactcccgctcgggcagctacgcgctgatc
tcggacgcctgccgcaccggggcgctggccgccgtggccgaggtgaatgccgggcccttc
gatctggagctggtgccggtcgagcgcgatcccggtggcaacatcgacttctatgcccct
ctgtgcgaagaacttctggcccatgaggggctgcgtcacgtcgtgggctgcgtcacctcc
tggagccgcaaggaggtgatcccgacgctggagaaggcgcgtgggacgctctggtatgcg
gtgccctacgagggcttcgaagcctcggaccatgtggtctatacccatgcctgcccgaac
cagcacctgctgccgctgctcgactgggcctttccggccttcggccgccgcgcctacctg
acggggtcgaactacatctggggctgggagatgaaccggctggcgcgcgagcggatcggg
gcagcgggcggcaaggttctgggcgaacgctacctgcccatcggatcgctcgagatcgac
cggatgatcgaggagatccgcgcgaccgcgccggatttcatcctgaattcgctgatcggc
ccctcctcctatgccttcctcaaggcctatcaggcgctggggcgcgaggatgcccgcttc
cgtccggaccgctgcccggtgatgtcctgcaacctcaccgaatgcgagctgcccgcgctg
ggggatgcggccgaggggctgatcgccgccggaccctacttccgcggcgagggccggttc
ggctcgtcgcacgaggcggcggcccatgcagcggtgatggagcttgcacgcctgctctcc
ggccgtccgggcgccgagcggcttccgctttcgcagctgctcgcagggtcccctccgggc
atcgtcgatccgcagacgcatcacaccgcgctgccggtcctgatctcacaggtctcgggc
ggccggttcacggtgcgcgagcgcctgcccgcacgtcccggggatccctacctgacccat
cccgcgcccgcacgcccggccacgctgcggatcgtgtcatga

DBGET integrated database retrieval system