KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3283Help
Entry
RSP_3283          CDS       T00284                                 

Definition
(RefSeq) myo-inositol 2-dehydrogenase
  KO
K00010  myo-inositol 2-dehydrogenase / D-chiro-inositol 1-dehydrogenase [EC:1.1.1.18 1.1.1.369]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00521  Streptomycin biosynthesis
rsp00562  Inositol phosphate metabolism
rsp01100  Metabolic pathways
rsp01120  Microbial metabolism in diverse environments
rsp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    RSP_3283
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSP_3283
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.18  inositol 2-dehydrogenase
     RSP_3283
    1.1.1.369  D-chiro-inositol 1-dehydrogenase
     RSP_3283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C 2-Hacid_dh_C NAD_binding_2 F420_oxidored NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 3721883
NCBI-ProteinID: YP_354791
UniProt: Q3IX44
Position
2:339817..340821
Genome map
AA seq 334 aa AA seqDB search
MTLRIGIIGTGAIGTDHARRINRVLSGAEVTAVTDVNRDSAEACVAGVAPGAQILGSAEE
VIAASDAVLVCSWGTAHETQVLAAIAAGKPCFCEKPLATEAYGARRIVEAEEAMGRRLVQ
VGFMRRYDRGYVALKETVRTRLGPPLMIHAAHRNPSVPGRYRTPMAIHDTLIHEIDVLRW
LLDDEYVSAQVIFPRATRHTHAGLRDPQIVLLETAKGVRIDVEIFVNCRYGYDIQCEVVG
EEGTARLPEPTAIPTRLGAVFGQPILMDWKDRFIDSYDVELQDFLKAAAQGTAAGPSAWD
GYAAAITADVCVQAQERPGAILPVTLPARPALYA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcgcattggcatcatcggcacgggagccatcggcaccgaccatgcacgccgc
atcaatcgggtgctgagcggggccgaggtcacggccgtcacggacgtgaaccgcgacagc
gccgaggcctgcgtggcgggcgtggccccgggggcgcagatcctcgggtcggccgaggag
gtgattgcggcgagcgacgccgtccttgtctgctcctggggcacggcccacgagacgcag
gtgctggccgccatcgcggcgggcaaaccctgcttctgcgagaaacccctcgcgaccgag
gcctatggcgcgcggcgcatcgtcgaggccgaagaggccatgggccgccgcctcgttcag
gtgggcttcatgcgccgctacgaccggggctatgtcgcgctgaaggagacggtgcgcacg
cggctcggcccgccgctgatgatccatgccgcgcatcgcaatccgagcgtgcccgggcgc
taccggacgccgatggcgatccacgacacgctgatccacgagatcgacgtgctgcgctgg
ctgctcgacgatgagtacgtctcggcgcaggtgatcttcccgcgcgccacccgccacacc
cacgccgggctgcgcgacccgcagatcgtgcttctcgagaccgcgaagggcgtgcggatc
gacgtggagatcttcgtcaactgccgctacggctacgacatccagtgcgaggtggtgggc
gaggagggcacggcccgcctgccggagcccacggcgatccccacgcggctcggggcggtg
ttcggccagccgatcctcatggactggaaggaccggttcatcgacagctacgacgtcgaa
ttgcaggatttcctgaaggctgcggcacagggcaccgccgccggtccctccgcctgggac
ggctatgccgcagccatcaccgcagatgtctgcgtgcaggcgcaggagaggcccggcgcc
atcctccccgtcaccctgccggcccgcccggccctctatgcgtaa

DBGET integrated database retrieval system