KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3323Help
Entry
RSP_3323          CDS       T00284                                 

Definition
(RefSeq) Putative flavoprotein containing monooxygenase involved in K+ transport
  KO
K07222  
putative flavoprotein involved in K+ transport
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:385161..386963
Genome map
AA seq 600 aa AA seqDB search
MLDQSESLALASLVAELERALVAQDAEAVADCFLETGFWRDLAAFTWNIKTCEGKGEIRA
MAGAQLGAIGPQALALDPAETVSSADGVTEGWLTFETATGRGMGHIRMKDGKVWTLLTAL
HELKGHEEPRRLRRPMGAEHGHDPHRKTWKEKREEEARRLGYEEQPYVLIVGGGQGGIAL
GARLRQLGVPTIILEKNERPGDSWRRRYKSLCLHDPVWYDHLPYIPFPDNWPVFAPKDKI
GDWLEMYTKVMELNYWSSSTARSARYEEAAGEWTVVVDRNGEEVVLRPKQLVLATGMSGK
ANVPSFPGQDIFRGEQQHSSQHPGPDAYKGKKVVVIGSNNSAHDICAALWEGGADVTMVQ
RSSTHIVKSDSLMEVCLSGLYSEQAVAQGIDHEKADMIFASVPYRIMHEFHIPQYEEIQR
RDADFYDALRKAGFLLDFGDDGSGLFMKYLRRGSGYYIDVGACDLVIDGSIKLKSGSDVS
HLTEEAVVLKDGTELPADLVVYATGYGSMNGWAADLISPEVADKVGKCWGLGSDTTKDPG
PWEGEQRNMWKPTMQEALWFHGGNLHQSRHYSRYLALQLKARQAGIETPVWGLQPPSHLR
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcaaagtgaaagtctggcgctcgcgtcgctggtggcagagctcgaacgggcg
ctggtggcgcaggacgcggaggcggtcgcggactgtttcctcgagaccgggttctggcgc
gacctcgcggccttcacctggaacatcaagacctgcgagggcaagggcgagatccgcgcc
atggccggcgcccagctcggggccatcggccctcaggcgctcgcgctcgatccggccgag
acagtcagttcggcggacggggtcacggagggctggctcaccttcgagacggcgaccggc
cgcggcatgggccacatccgcatgaaggacggcaaggtctggacgctcctgactgcgctc
catgagctgaaggggcacgaggagccgcgccgcctgcgccggccgatgggggccgagcac
ggccacgatccgcaccgcaagacctggaaggagaagcgcgaggaggaggcgcggcgactg
ggctacgaggagcagccctatgtcctcatcgtgggcggcggtcagggcgggatcgcgctt
ggcgcgcggctgcgccagctcggggtgcccacgatcatcctcgagaagaacgagcggccc
ggcgacagctggcggcggcgctacaagtcgctctgcctgcatgacccggtctggtatgac
cacctgccctacatccccttcccggacaactggccggtcttcgcgccgaaggacaagatc
ggtgactggctcgagatgtatacgaaggtgatggagctgaactactggtcctcgagcacg
gcgagatccgcccgctacgaagaggccgcgggcgagtggacggtggtcgtcgaccgcaac
ggcgaggaggtggtgctgcgcccgaagcagctcgtgctcgccaccggcatgtcgggcaag
gccaacgtgccgagcttcccgggacaggacatcttccgcggcgagcagcagcattcgagc
cagcatcccggccccgacgcctacaagggcaagaaggtggtggtgatcggctcgaacaac
tcggcgcacgacatctgcgcggctctgtgggagggcggggccgatgtcacgatggtgcag
cggtcctcgacccatatcgtgaagtcggacagcctgatggaggtctgcctctcggggctc
tattccgagcaggcggtggcgcagggcatcgaccacgaaaaggccgacatgatcttcgcc
tcggtgccctaccggatcatgcacgagttccacatcccgcagtatgaggagatccagcgc
cgcgacgccgacttctacgacgcgctgcgcaaggcgggcttccttctcgacttcggcgac
gacggttcgggcctgttcatgaaatacctgcgccgcgggtcgggctactacatcgatgtg
ggcgcctgcgatctggtcatcgacggctcgatcaagctgaagtcgggctcggacgtgagc
cacctcaccgaagaggcggtggtgctgaaggacggcaccgagctgccggcggatctggtg
gtctatgccacgggctatggctcgatgaacggctgggccgcagatctcatcagcccggaa
gtggccgacaaggtgggcaaatgctggggcctcggttccgacacgaccaaggatcccggc
ccctgggagggcgaacagcgcaacatgtggaagcccacgatgcaggaggcgctctggttc
cacggcggcaacctgcatcagtcgcgccactattcgcgctacctcgcgctgcagctgaaa
gcccggcaggccgggatcgagacgcccgtctggggcctccagcctcccagccacctgcgc
tga

DBGET integrated database retrieval system