KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3328Help
Entry
RSP_3328          CDS       T00284                                 

Definition
(RefSeq) hypothetical protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porin_4 OMP_b-brl
Motif
Other DBs
NCBI-GeneID: 3722028
NCBI-ProteinID: YP_354832
UniProt: Q3IX03
Position
2:complement(391441..392352)
Genome map
AA seq 303 aa AA seqDB search
MTPRYLVISTILASALPLPLLAQTFDGAVTLGYGETNVSDTDSDVTTLSLAGRFGLDLGN
GLRFGLDLATASLDDGDDDVTRSFAGVTGSYGFQNGASLGLYGEQARLDLDGFGDATMKS
YGLTAGYEAEGALVTGFYGESDIDDLPSGIDLTDFGASFRYSGFANGLVGVNLQRTTLSA
DGFEDVDLDVLGIAGSYDLQAGWTLFGGLTGASLDVIDADLTTLGVGVSYDLSQATQANA
VVSLELARSELDVMGLDGHGTTVRLGLSIPLGGRSASVPLGSVADTVLNPRHSALSSTLF
SAF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacccctcgttatcttgtaatttcgaccatccttgccagtgcactgcctctgccgctc
ctcgcgcagaccttcgacggagcggtgactctgggctatggggagaccaacgtctcggac
accgacagcgacgtgacgacgctgagcctcgccggccgcttcggcctcgacctgggcaac
ggcctgcgcttcggtctcgacctcgcgaccgcctcgctggacgatggcgacgacgatgtg
acccgcagcttcgcgggcgtgaccggcagctacggcttccagaacggcgcctcgctcggc
ctttacggcgaacaggcccgcctcgacctcgacgggttcggcgacgccaccatgaagtcc
tacggcctcaccgcgggctatgaggccgagggcgcgctcgtgaccggcttctacggcgag
agcgacatcgacgacctgccctcgggcatcgatctcaccgacttcggcgcgagcttccgc
tacagcggcttcgcgaacgggctcgtgggcgtgaacctccagcgcacgaccctctcggcc
gacgggttcgaggatgtggatctggatgtgctgggcatcgccggatcctacgacctgcag
gcgggctggaccctgttcggcggtctgaccggcgcttcgctcgacgtgatcgacgcggac
ctgaccactctcggggtgggcgtctcctacgacctgtcgcaggcgacccaggccaatgcc
gtcgtctcgctcgaactggcgcggtcggagctggacgtgatggggctcgacggccacggg
acgaccgtccgtctgggcctgagcatcccgctcgggggccgcagcgcctcggtgccgctc
ggcagcgtggccgacacggtcctgaacccgcgccacagcgcgctgagctcgaccctcttc
tcggccttctga

DBGET integrated database retrieval system