KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3333Help
Entry
RSP_3333          CDS       T00284                                 

Definition
(RefSeq) putative effector of murein hydrolase LrgA
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LrgA
Motif
Other DBs
NCBI-GeneID: 3722034
NCBI-ProteinID: YP_354838
UniProt: Q3IWZ7
Position
2:complement(397632..397985)
Genome map
AA seq 117 aa AA seqDB search
MISHLTLLLLLQLAGEALARGAALPVPGPILGLLMLLALFAARQGLAERLRPTNAAILSY
MSLLFVPAGVGIVGHLGLLADEAVPLLVTLVASTVLALLAAAVAFAAVARLTGPRDA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgatctctcatctgacgctcctcctgctcctgcaactcgcaggcgaggctctggcccga
ggcgcggcacttcccgtgccggggccgatcctcgggcttctgatgctgctcgcgctcttt
gcggcgcgtcaggggctggccgagcggcttcgtcccaccaatgccgcgatcctgtcgtac
atgtcgctcctgttcgtgccggctggggtggggatcgtgggccatctcgggctgctcgcc
gacgaggcggtgccgcttctggtgacgctggtcgcgagcacggttctcgcgcttctggcc
gcggccgtggccttcgccgccgtggcccggctgacggggccgcgcgatgcgtga

DBGET integrated database retrieval system