KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3342Help
Entry
RSP_3342          CDS       T00284                                 

Gene name
bfr
Definition
(RefSeq) Bacterioferritin
  KO
K03594  bacterioferritin [EC:1.16.3.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00860  Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSP_3342 (bfr)
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.1  ferroxidase
     RSP_3342 (bfr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferritin Rubrerythrin Ferritin_2
Motif
Other DBs
NCBI-GeneID: 3722043
NCBI-ProteinID: YP_354847
UniProt: Q3IWY8
Position
2:405854..406351
Genome map
AA seq 165 aa AA seqDB search
MKGDDKVIDYLNKALRSELTAVSQYWLHYRLQEDWGFGAIADKSRAESIEEMHHADRLIA
RIIFLEGHPNLQALDPLRIGQTLKETLEADLAAEHDARTLYIEARDHCESVRDYVSKDLF
ESLIADEEGHIDFLETQLELMESIGVQNYGMLNAKSADKAESGDH
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgacgacaaggttatcgactatctcaacaaggcgctgcggtcggagttgaca
gccgtcagccagtattggctgcactaccgcctgcaggaggactggggcttcggcgcgatc
gccgacaaatcccgcgccgagagcatcgaggagatgcaccacgccgaccggctgatcgcc
cggatcatcttcctcgaggggcatccgaacctgcaggcgctcgacccgctgcggatcggc
cagaccctcaaggagacgctcgaagccgacctcgccgccgaacatgacgcgcgcaccctc
tatatcgaggcgcgggatcattgcgaaagcgtgcgcgactatgtctcgaaggacctgttc
gagtcgctgatcgcggacgaagagggccatatcgacttcctcgagacgcagctcgagctg
atggagagcatcggcgtgcagaattacgggatgctcaacgcgaagtcggccgacaaggcc
gagagcggcgaccactga

DBGET integrated database retrieval system