KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3344Help
Entry
RSP_3344          CDS       T00284                                 

Definition
(RefSeq) PAS sensor diguanylate cyclase
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:complement(408144..409616)
Genome map
AA seq 490 aa AA seqDB search
MTATTRPIEEAAFDLAPISMWIEDFSGVRALFDQWRAEGVTDIRAFLEADLSRVAACSRS
IKVLRVNARTLALYEARDLAHLTENLERVFRDDMLQSHVNELSQLWAGEQTFSSLAVNYT
LGGRRLDIQLRGAVLPGSEQSLDRILLTCEDVTAREEARRLERASRRYAEGIFEYSPTSL
WVEDFSQIRQLLENLRARGIVDLRVFTDVHPEFVRQCMGEIRVIDVNQATLDMFCAPDKR
TLLSHLRDIFRDSMEPHFREQLIELWNHHYYHSREVVNYALDGSERAVIMHFAVLPGHEH
DWSLVQVALTDITARKKAEAYLAYLGKHDVLTGVNNRAFYIDELNRLERQGVRPVSIVML
DLNGLKGVNDALGHDAGDQLLRRLGEVLKEAAAETNHPARIGGDEFAVVMPRSSEAMAQA
MVDTIKRLLTVNNRFHFMAPLSVSIGHATSQPNETMEATIKRADRHMYEEKRKFYAEADR
RGAQASRTAS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctacgacgaggccgatcgaagaggctgccttcgatctcgccccgatctcgatg
tggatcgaggatttcagcggcgtccgggccctgttcgaccagtggcgcgccgagggcgtg
accgacatccgggccttcctcgaggccgacctgtcgcgtgtcgccgcctgttcgcggagc
atcaaggttctcagggtgaatgcccgcacgctcgccctctacgaggcgcgcgatctcgcc
catctgacggagaacctcgaacgggtctttcgcgacgacatgctccagagccatgtgaac
gagctgtcgcagctctgggcgggcgagcagaccttctccagcctcgcggtcaactataca
ctgggcgggcgccggctcgacatccagctgcgcggggcggtgctgcccggatccgaacag
agcctcgatcggatcctcctgacctgcgaggatgtgaccgcccgcgaagaggcgcgcagg
ctcgaacgcgcgagccggcgctacgccgagggcatcttcgaatattcgccgacctcgctc
tgggtcgaggatttcagccagatccgccagcttctcgaaaatctgcgcgcgcgcgggatc
gtggatctgcgggtcttcaccgacgtccaccccgagttcgtccggcaatgcatgggcgag
atccgggtgatcgacgtgaaccaggccacgctcgacatgttctgcgcccccgacaagcgc
acgcttctcagccatctgcgcgacatcttccgcgacagcatggagccgcatttccgcgag
cagctgatcgagctctggaaccatcactattaccacagccgcgaggtggtgaattacgcg
ctcgacggcagcgaacgggcggtcatcatgcatttcgccgttctgcccgggcacgagcac
gactggtcgctggttcaggtggcgctgaccgacatcacggcccgcaagaaggccgaggcc
tacctcgcctatctcggcaagcacgatgtgctgacgggggtgaacaaccgggccttctac
atcgacgagctgaaccggctcgagcggcagggggtgcggccggtctccatcgtgatgctg
gatctgaacggactgaagggcgtgaacgacgcgctcggccatgacgcgggcgaccagctg
ctccggcggctgggcgaagtgctgaaggaggcggcggccgagacgaaccatcccgcccgc
atcgggggcgacgaattcgcggtggtcatgccgcggtcgagcgaggcgatggcgcaggcg
atggtcgacacgatcaagcggctcctcacggtgaacaaccgcttccatttcatggccccg
ctctcggtctcgatcggccatgcgacgagccagcccaacgagacgatggaggccacgatc
aagcgggccgaccggcacatgtatgaggaaaagcgcaagttctacgccgaagccgaccgg
cgcggagcgcaggccagccggacggcaagctag

DBGET integrated database retrieval system