KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3347Help
Entry
RSP_3347          CDS       T00284                                 

Definition
(RefSeq) methionine synthase (B12-dependent)
  KO
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RSP_3347
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    RSP_3347
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    RSP_3347
Enzymes [BR:rsp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     RSP_3347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:complement(413910..414989)
Genome map
AA seq 359 aa AA seqDB search
MKPFPLWSPLLLLIRPDSMLTFSLPPSRAVPALEALVRQRILILDGAMGTQIQALGLSEE
DYAGCGCRHHAERPQKGNNDLLILTQPQAIEEIHFRYAMAGADIVETNTFSATTIAQADY
GMESAVEDLNREGARIVRRALDRATALDGRPRFVAGAVGPTNRTASISPDVNDPGYRAVS
FDDLRMAYGTQVRALIAGGADLILIETIFDTLNAKAAIFACFEAFAEAGRRLPLMISGTI
TDASGRTLSGQTPTAFWHSVRHARPFTVGLNCALGAAAMRPHLAELAGVADAAICAYPNA
GLPNAFGQYDEGPDETAAQVARFAREGLVNVVGGCCGTTPDHVRAIACAVADLPPRTLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccttcccgctatggtctccgcttctcctcctgatccgaccggactccatgctg
accttttcccttccgccctcccgcgccgttccggctctcgaggccctcgtgcgccaacgc
atcctgatcctcgacggggcgatgggcacccagatccaggcgctcgggctgagcgaggag
gattatgccggctgcggctgccgccaccacgccgagcggccgcagaagggcaacaacgac
ctcctgatcctgacccagccgcaggccatcgaggagatccatttccgctatgccatggcg
ggtgccgacattgtcgagaccaacaccttctcggccaccaccatcgcgcaggccgattac
gggatggagagcgcggtcgaggatctgaaccgcgagggggcgcggatcgtgcggcgcgcg
ctcgatcgggcgacggcgctcgacgggcggccgcgcttcgtggcgggcgcggtggggccc
accaaccgcaccgcctcgatcagccccgacgtcaacgatccgggctaccgcgctgtgagc
ttcgacgatctgcgcatggcctacggcacgcaggtgcgggcgctgatcgcgggcggcgcg
gatctcatcctgatcgagacgatcttcgacacgctgaatgcgaaggccgcgatcttcgcc
tgtttcgaggccttcgccgaggccggccgccggctgccgctgatgatctcgggcacgatc
accgacgcgtcgggccgcacgctctcgggccagacgccgaccgccttctggcattcggtg
cgccatgcgcggcccttcacggtggggctgaactgtgcgctcggagccgcggccatgcgg
ccccatctggccgagcttgcgggtgtggccgatgccgcgatctgcgcctatccgaacgcg
ggcctgcccaacgccttcggccagtatgacgagggcccggacgagacggcggcgcaggtc
gcccgcttcgcccgcgaagggctcgtcaatgtcgtgggcggctgctgcggcaccacgccc
gaccatgtccgcgccatcgcctgcgcggtggccgatcttccgccaaggaccctcgtatga

DBGET integrated database retrieval system