KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3351Help
Entry
RSP_3351          CDS       T00284                                 

Definition
(RefSeq) hypothetical protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:417536..417769
Genome map
AA seq 77 aa AA seqDB search
MKKRTSAQALLDHYLTAPVERAGPPGAGRRLSPKEQAAERTTEAARRQIEADTEERAAKS
RRLAAARLGKDAPGRDG
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacgcacttcggcgcaggccctgctcgaccactatctgaccgcgccggtcgag
cgtgcgggccctcccggagccgggcgccgtctttcccccaaggaacaggccgccgaacgc
acgaccgaggcggcgcggaggcagatcgaggccgataccgaggagcgcgcggccaagtcc
cgccgcctcgccgcggcccgcctcggcaaggacgcccccggccgagacggctga

DBGET integrated database retrieval system