KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3361Help
Entry
RSP_3361          CDS       T00284                                 

Definition
(RefSeq) Putative restriction endonuclease or methylase
  KO
K07504  predicted type IV restriction endonuclease
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSDR_N_2 HSDR_N PDDEXK_3 ATPase
Motif
Other DBs
NCBI-GeneID: 3722061
NCBI-ProteinID: YP_354865
UniProt: Q3IWX0
Position
2:424847..425914
Genome map
AA seq 355 aa AA seqDB search
MSSMSIEQTIKVLSERVRQHSANMMTEEAVKTAVVLPFLQSLGYDVFNPFEVVPEFTADA
VGKKGEKVDYAIKLENEIRILVECKPISTNLDKVHLAQLFRYFTVTSAKFAILTNGRYFH
FHTDLDEPNKLDSRPFFTFDLAEPHAQVLAELKKFEKIGFDVDTILANAERLKYTSAIKA
HIHRIMEDPPEELIRLVTAPLHEGRYTAAVIDQFRGLLKSAFKEMIREAVHERLSSALAS
NEPVAEPSELEPSEPDVVTTQEEMEGFMMVKAIVAGTIKPGRVHMRDQKSYCGILVDNNN
RRPLARLHFNRSVKYIGLFDGEQEERVPLTSTDDIYAYAERLRVTAARYVEMSST
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaatgtctatcgagcaaacgatcaaggttctctctgagcgggtcaggcagcac
agcgcgaacatgatgacggaagaggcagtcaagacagcagtcgtcctgccgtttcttcag
agcctcggatacgacgtcttcaaccctttcgaggttgttccggagttcacggcggacgcg
gtaggaaagaaaggcgagaaggtcgattacgcgatcaagctcgagaacgaaatccgcatc
cttgtcgagtgcaaaccgatcagcacgaacctcgacaaggtgcacctcgcacagctcttc
cgctacttcacggtcaccagcgcgaaattcgccatcctgacgaacggccgctacttccac
ttccacacggatctcgacgaaccaaacaagctggatagccgacccttctttacgttcgat
ctggccgagccgcacgctcaggttctggcggagttgaagaagttcgaaaaaatcggcttt
gacgtcgacacgattctcgcgaatgcagagcggcttaaatatacgtcagctattaaggct
cacatccatcggatcatggaggatccgcccgaggaactgattcgcttggtaaccgctccg
ctccatgaaggacgatatacggcagccgtgattgatcagttccgcggactcttgaaatct
gcgttcaaagagatgatccgcgaggcagtacatgaacggctttcgtcggctctcgccagt
aacgagccggtagccgaaccgtctgaattggaaccttcagaaccagacgtcgtcacgacg
caggaggagatggagggcttcatgatggtcaaggcaatcgtcgcaggtacgatcaagcca
ggccgcgtacatatgcgtgatcagaagagctactgcgggatcctcgttgacaacaacaac
cgccgtccgctggcacgtctccacttcaatcgttcggtcaagtacatcgggctattcgac
ggtgagcaagaggaacgcgttccgcttacgtccacggatgacatctatgcctacgctgag
cgcctccgagtgactgccgctcgatacgtcgaaatgtccagcacctag

DBGET integrated database retrieval system