KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3364Help
Entry
RSP_3364          CDS       T00284                                 

Gene name
proC
Definition
(RefSeq) pyrroline-5-carboxylate reductase
  KO
K00286  
pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RSP_3364 (proC)
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     RSP_3364 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:428041..428862
Genome map
AA seq 273 aa AA seqDB search
MDLADLGRRGLVLLGCGKMGSAMLEGWLGRGLALSAVWVTDPRPSDWLKSLAARGLHLNE
ALPDEPAVVLVAVKPQMMSEALPGLAALGEGRVLFLTVAAGTPISYYERTLGAATPVIRA
MPNTPAAVGRGITALVGNAAASEAQMALAEDLLSAVGQVVRLEGEHQMDAVTAVSGSGPA
YVFHLIEALAAAGEAEGLPADLAMTLARATVTGAGELAHRAPESASQLRVNVTSPGGTTA
AALGVLMDPESGLPPLLRRAVKAAADRGRELGR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgcggatcttggccgccgggggctggtgctgctcggctgcgggaagatgggc
tcggcgatgctcgagggctggctcggacggggccttgcgctctccgccgtctgggtgacg
gaccccaggccgtcggactggctgaaatcgctcgcggcgcgcgggctgcatctgaacgag
gcgctgcccgacgagcccgcggtggtgctggtcgcggtcaagccgcagatgatgtccgag
gccctgccggggctcgcggcgctcggcgaagggcgggtgcttttcctgacggtcgcggcg
ggcacgcccatctcctattacgaacgcacgctgggcgcggccacgccggtgatccgcgcc
atgccgaacacacccgcggcggtcggccgcggcatcacggcgctggtgggcaatgctgcc
gcctcggaggcgcagatggcgctggccgaggatctcctctcggcggtgggccaggtggtc
cggctcgagggcgagcatcagatggatgcggtgaccgcggtctcgggctcggggccggcc
tatgtcttccacctgatcgaggcgctcgccgcagcgggcgaggccgaggggctgccggcc
gatctcgccatgaccctcgcccgcgccaccgtcaccggcgcgggcgagcttgcccatcgc
gcgccggaaagcgcgagccagctgcgcgtgaacgtgacctcgccggggggcacgacggcg
gcggcgctcggcgtgctgatggatcccgagagcggcctgccgccgctcctccgccgcgcg
gtgaaggctgcggccgaccgcggacgggagctcggccgatga

DBGET integrated database retrieval system