KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3366Help
Entry
RSP_3366          CDS       T00284                                 

Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase
  KO
K00090  
glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Pentose phosphate pathway
Glycine, serine and threonine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSP_3366
   00620 Pyruvate metabolism
    RSP_3366
   00630 Glyoxylate and dicarboxylate metabolism
    RSP_3366
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSP_3366
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     RSP_3366
    1.1.1.81  hydroxypyruvate reductase
     RSP_3366
    1.1.1.215  gluconate 2-dehydrogenase
     RSP_3366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:429188..430135
Genome map
AA seq 315 aa AA seqDB search
MRLLITRPLPDRILEAARARFEVTVRNSTKPLSPEELRRALAEHDAVLPTLGDLFRAEVF
ADVPQPRARILANFGVGTNHIDVAAATAAGIAVTNTPGAVTDATADIALTLMLMTARRAG
EGERLVRRGAWEGWHPTQMLGLHMTGKRLGILGMGRIGKAIARRAHHGFGMEITFFNRSP
VADPGVPARQVGLAEALDADIVVVAVPATPATHHLVDAAALSQMRPGAILVNIARGDIVD
ETALIAALAEGRLAGAGLDVYEFEPEVPAALRAMENVTLLPHLGTAALEVREGMGLMAVE
NLLAFADGRPLPNAV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgagactgctcatcacccgccccctgcccgaccggattctcgaggccgcccgcgcccgg
ttcgaggtcacggttcgcaacagcaccaagccgctctcgcccgaggagctgcgccgcgcg
ctggccgagcacgatgccgtgctgccgacgctgggcgatctcttccgcgccgaggtcttc
gccgacgtgccgcagccgcgcgcccggatcctcgccaacttcggcgtggggacgaaccat
atcgacgtggccgccgcgaccgccgccgggatcgccgtcaccaacacgccgggcgccgtc
accgacgccaccgccgacatcgcgctcacgctaatgctgatgacggcgcgccgggccggc
gaaggcgagcggctggtgcgccgcggcgcgtgggagggctggcatccgacgcagatgctc
ggtctccacatgacgggaaaacggctcggcatcctcggcatgggccggatcggcaaggcc
atcgcgcgccgcgcccaccacggcttcgggatggagatcaccttcttcaaccgctcgccc
gtcgccgatccgggcgtccccgcccgacaggtgggattggccgaggcgctggacgccgat
atcgtcgtggtggccgtgcccgcgacgcccgcgacccaccatctcgtcgatgcggcggcg
ctcagccagatgcggcccggcgcgatcctcgtcaacatcgcccgcggcgacatcgtcgac
gaaacggcgctgatcgcggcactcgccgaaggccggctcgccggcgcggggctcgacgtc
tacgagttcgagcccgaggtgcccgccgcgctccgcgcgatggagaatgtgaccctcctg
cctcatctggggaccgcggccctcgaggtgcgcgagggcatggggctcatggcggtcgag
aacctcctggccttcgccgacggccggccgctgccgaacgcggtctga

DBGET integrated database retrieval system