KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3367Help
Entry
RSP_3367          CDS       T00284                                 

Definition
(RefSeq) sulfotransferase family protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfotransfer_2
Motif
Other DBs
NCBI-GeneID: 3722067
NCBI-ProteinID: YP_354871
UniProt: Q3IWW4
Position
2:430344..431009
Genome map
AA seq 221 aa AA seqDB search
MILSRARRFIFVHIPKAGGSALALALEARARKDDILIGDTPKARSHRAGLRGVKARGRLW
THSTLADIAGLLTDAEIESFFTLTLVRNPWDRALRYYLWLRGQSFAHPAVGLAKSLDFSG
FLNHPQTQTSFRLWPASAYMRDRHGVERASLYLRAEHLEEDLPPFEAHLGFRLAPLRRTG
DSGPPQDWRSSYSDADAALLARLCAEDIGRFHYRFDDAAGR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatcctctcccgtgcccgccgcttcatcttcgtccatatcccgaaggccggcggcagc
gccctggcgctcgcgctcgaggcccgtgcgcgcaaggacgacatcctgatcggcgacacg
cccaaggcccgcagccaccgcgccggactgcgcggggtgaaggcgcgcggacggctctgg
acccactccactctcgccgatatcgcgggcctgctcaccgacgccgagatcgagagcttc
ttcaccctgaccctcgtgcgcaacccgtgggaccgcgcgctgcgctactatctctggctc
cgcggccagagcttcgcccatcctgcggtgggccttgccaaatcgctcgatttctcgggc
tttctcaaccatccgcagacccagacctccttccggctctggcccgcctccgcctacatg
cgcgaccggcatggggtggagcgcgcgagcctctatctgcgggcggagcatctcgaggag
gatctgccgcccttcgaggcgcatctgggcttccgcctcgcgcccctgcgccgcacgggc
gactccggcccgccgcaggactggcgcagcagctacagcgacgccgatgcggccctcctc
gcgcgtctctgcgccgaggatatcggccgtttccactatcgcttcgacgatgcggccggg
cggtga

DBGET integrated database retrieval system