KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3372Help
Entry
RSP_3372          CDS       T00284                                 

Definition
(RefSeq) TRAP-T family transporter, periplasmic binding protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:complement(436485..437624)
Genome map
AA seq 379 aa AA seqDB search
MTAFEKKAAYSRRSFLRTGALAGGAAAGSVLAAPAVLAQAPLVMKMQTSWPASDIWMDFA
REYVTRVEEMSGGRIKVDLLPAGAVVGAFQVMDAVHDGVIDASHSVSAYWYGKSKAASFF
GTGPVFGGSATTMLGWFYQGGGQDLYRELTQDILGMNIVGFYGFPMPAQPFGWFKTEVNG
VADIQGFKYRTVGLAADLLQAMGMSVAQLPGGEIVPAMERGVIDAFEFNNPSSDMRFGAQ
DVAKNYYLSSYHQASESFEYTFNRDFYEDLDPDLQAILKYAVEAASTSNTALALRQYSAD
LATLAAENGVAVHRTPKDILSGQLEAWDKLIVDLEADEFFKKVLDSQRAWVEQVSYYELM
NAADLGLAYEHHFPGKLKL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacggctttcgagaagaaagcggcgtattcgcgccgctcgttcctgcgcaccggtgcc
ttggccgggggtgcggcggcggggtctgtcctggcggctccggccgttctggcccaagcg
ccgctggtgatgaagatgcagacatcctggcctgcctcggacatctggatggacttcgcc
cgcgaatatgtcacgcgggtcgaggagatgtcgggcggcaggatcaaggtggacctgctg
ccggccggggccgtggtcggcgccttccaggtgatggatgccgtgcatgacggtgtgatc
gacgcttcgcattcggtgtcggcctactggtacggcaagtcgaaggcggcctcgttcttc
ggcacgggcccggtcttcggcggttcggccaccacgatgctcggctggttctatcagggc
ggcggtcaggatctctaccgcgagctgacccaggatattctcggaatgaacatcgtgggc
ttctacggcttcccgatgccggcccagcccttcggctggttcaagaccgaggtgaacggc
gtcgccgacatccagggcttcaaataccggaccgtggggctggcggccgacctgctgcag
gcgatgggcatgtcggtggcgcagctgcccggcggcgagatcgtgccggcgatggagcgg
ggcgtgatcgacgccttcgagttcaacaacccctcgtcggacatgcgcttcggcgcgcag
gacgtggcgaagaactattatctctcctcctaccatcaggcgtccgagagcttcgaatat
acgttcaaccgcgatttctacgaggatctggatcccgatctgcaggcgatcctgaaatat
gcggtggaggcggcctcgacctcgaacacggcgctggcgctgcgccagtattcggccgat
ctcgcgacgctcgcggccgaaaacggggtcgcggtgcatcggaccccgaaggatatcctt
tcgggccagctcgaggcgtgggacaagctgatcgtggatctcgaggccgacgagttcttc
aagaaggtcctcgacagccagcgcgcctgggtggagcaggtaagctattacgagctgatg
aacgcggccgacctcgggctggcctacgaacatcacttccccggcaagctcaagctctga

DBGET integrated database retrieval system