KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3375Help
Entry
RSP_3375          CDS       T00284                                 

Definition
(RefSeq) Membrane fusion protein, HlyD family
  KO
K02005  
HlyD family secretion protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:complement(439707..440984)
Genome map
AA seq 425 aa AA seqDB search
MAAGEGPMTDRSDDLARILDRRRRGRRWLWPLLALGLLAGGGLLWASRQGAEPALAYVTE
PVERGGLVVTVMATGTVQPTTQVEVSSELSGTLAAVEVDYNDEVAVGQPLARLDDTRLKA
QVANAEASLEAAEGRLEQARATALEAAENYRSRSALDQRGVAAHLDLVATEAAHKRAESE
VKIAEADRTLAAANLEVQRVDLAKAVIRSPIRGIVLDRAAEAGQIVASSLNTPVLFTLAE
DLTRMELRVDIDEADIGRVRVGNRASFKVDAYPGRSFKAEIVQVRYAPETTDGVVTYKAV
LSVDNGERLLRPGMTATATITVAEVEGALLVPNAALRFAPPAVAQPGSSGGNRGGGLLGL
IMPRAPGPMSEADATSGPTVWVLRDGEPDRVAVETGETDGRRTEIRGGALEEGAPVITDQ
REAGA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgccggagaaggacccatgaccgacaggagcgacgatctcgcccgcatcctcgac
cgacgccgccgcgggcggcgctggctctggcccctgctggcgctggggctgcttgcgggc
gggggcctcctctgggcctcgcggcagggggcggagcccgcgcttgcctatgtgaccgag
ccggtggagcggggcgggcttgtcgtgacggtgatggccacgggcacggtgcagcccacg
acgcaggtcgaggtttcctcggaactgtcgggcacgctcgccgcggtggaggtggattac
aacgacgaggtcgcggtgggccagccgctcgcccggctggacgacacgcggctgaaggcg
caggtcgccaatgccgaggcctcgctcgaggcggcggaggggcggctcgaacaggcccgc
gccaccgcgctcgaggcggccgagaactaccgctcgcgctcggcgctcgaccagcggggc
gtggccgcccatctcgatctcgtggcgaccgaggccgcccacaagcgcgcggaatccgag
gtaaagatcgccgaggccgaccgcacgctcgcggctgccaatctcgaggtgcagcgggtg
gatctggccaaggccgtgatccgctcgccgatccgcggcatcgtgctcgaccgggcagcg
gaggcggggcagatcgtggcctcctcgctgaacacgccggtgctgttcacgctggccgag
gatctgacccggatggagctgcgcgtcgacatcgacgaggccgacatcggccgggtgcgg
gtgggcaaccgcgcctccttcaaggtggacgcctatccggggcggagcttcaaggccgag
atcgtgcaggtgcgctacgcgcccgagacgaccgacggcgtggtgacctacaaggcggtg
ctgtcggtggacaatggcgagcggctgctgcggcccggtatgaccgcgaccgcgacgatc
acggtggccgaggtggagggcgcgctcctcgtgccgaatgccgcgctgcgcttcgccccg
ccggcggtggcccagcccggcagttccggcggcaaccgcgggggcgggctgctcgggctc
atcatgccccgcgcccccgggccgatgagcgaggcggacgccacgtcgggccccacggtc
tgggtcctgcgcgacggtgagcccgaccgggtggcggtcgagaccggcgagaccgacggg
cggcggaccgagatccgcggcggcgcgctcgaggagggggctccggtcatcaccgatcag
cgcgaggccggagcttga

DBGET integrated database retrieval system