KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3377Help
Entry
RSP_3377          CDS       T00284                                 

Definition
(RefSeq) Glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RSP_3377
Enzymes [BR:rsp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RSP_3377
Transporters [BR:rsp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RSP_3377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_4 Inhibitor_I68 GST_C_2 PRIMA1 GST_N
Motif
Other DBs
NCBI-GeneID: 3722079
NCBI-ProteinID: YP_354882
UniProt: Q3IWV3
Position
2:441674..442558
Genome map
AA seq 294 aa AA seqDB search
MTYELAIGDRAYSSWSLRGWLLFDAFGLPVRVRRARLYTDELPALLADFAPARTVPAMKT
SAGTVVAESLAIAEELASRHPEAGIWPADPEHRAVARALAAEMHAGFGALRSHCPMNLRV
SYEGCDPPEAVQADLARLERIWAEARARCSTEGPWLCGSYSAADVFFAPVAARIAGYGLA
VSPEAQAYVAAHLAHPSFRRWRAMGAVDGADQEFYARPYPPRPWPGPAPLPARAVADGVA
ENDACPYSGAPVTDLLEIEGRIFGFCNPFCRDKTVADPEAWPAFTALLRHREGS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgacctacgagcttgccatcggcgatcgcgcctattccagctggagcctgcgcggctgg
ctcctcttcgatgccttcgggcttcccgtccgcgtgcggcgcgcccggctctataccgac
gagctgcccgcgcttctggccgatttcgcccccgcccgcaccgtgcccgcgatgaagacg
tcggccggaacggtggtggccgaaagcctcgccatcgccgaagagctcgcctcgcgccat
cccgaggcggggatctggcccgccgatcccgagcatcgggcggtggcgcgcgcactcgcg
gccgagatgcatgcgggcttcggggcgctccgcagccactgccccatgaacctccgcgtg
agctacgagggctgcgacccgcccgaggccgtgcaggccgatctcgcccggctcgaaagg
atctgggccgaggcccgggcgcgctgcagcaccgagggcccgtggctctgcggatcctac
agcgcggcggatgtgttcttcgcccccgtcgcggcacgcatcgcaggctacgggctcgcc
gtcagccccgaggcgcaggcctatgtggcggcccatctcgcccatccctccttccgccgc
tggcgcgcgatgggggcggtcgatggcgccgatcaggagttctacgcccggccctatcca
ccaagaccctggcccggccccgcgcccctgcccgcccgcgccgtggcggacggcgtggcc
gagaacgacgcctgcccctattcgggcgcgccggtgaccgacctgctcgagatcgagggg
cgaatcttcggcttctgcaaccccttctgccgcgacaagaccgtggccgaccccgaggcc
tggcccgccttcacggcactgctgcgtcaccgtgagggatcgtga

DBGET integrated database retrieval system