KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3379Help
Entry
RSP_3379          CDS       T00284                                 

Definition
(RefSeq) RES domain-containing protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RES
Motif
Other DBs
NCBI-GeneID: 3722081
NCBI-ProteinID: YP_354884
UniProt: Q3IWV1
Position
2:443233..443883
Genome map
AA seq 216 aa AA seqDB search
MAKFPEPPPAATLAALGPEIATLPAGTPLARIFFRGGDHPVGWNDFRFWGPGSGRFDPHL
PDALGAPQVQARGILYAAGSAAPGALAVCAAEVFQETRIIDLTGRSPWFAVFALARPLTL
LDLTGLWPTRAGASAAIASGPKARARRWSRAFYEAFPAIDGLLYPSSMGGNAPVMALYER
ARPALPDSPDFHRALADPALRVPVLRAAGVIGYLVA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttccccgaaccgccgcctgccgcgacgctggcggcgctcggccccgagatc
gcgaccctgcccgccggcacgccgctcgcgcggatcttctttcgcggcggcgatcatccc
gtgggctggaacgatttccgcttctggggccccggcagcggccggttcgatccccacctg
cccgacgcgctgggcgccccgcaggtgcaggcgcgcggcatcctctatgcggccgggtcc
gccgcgccgggcgcgctcgccgtctgcgcggccgaggtctttcaggagacgcggatcatc
gacctcaccggccggtcgccgtggtttgcagtcttcgcgctggcccggcccctgacgctc
ctcgatctgaccggcctctggcccacgcgggccggcgcctccgcggccatcgcctcgggg
ccgaaggcccgcgcccgccgctggagccgcgccttctacgaggcttttccggccatcgac
gggctgctctacccctcctccatgggcggcaatgcccccgtcatggcgctctacgagcgg
gcgcgcccggcgctgcccgacagccccgacttccaccgcgccctcgccgatcccgcgctg
cgcgtgcccgtcctgcgcgcggcgggggtcatcggctatctcgtcgcctga

DBGET integrated database retrieval system