KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3380Help
Entry
RSP_3380          CDS       T00284                                 

Definition
(RefSeq) SH3 type 3 domain protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1236 SH3_3 SH3_4
Motif
Other DBs
NCBI-GeneID: 3722082
NCBI-ProteinID: YP_354885
UniProt: Q3IWV0
Position
2:444119..444784
Genome map
AA seq 221 aa AA seqDB search
MTRNSTLWLSVAAATLLAGAASAQVQEARPMTDLNLRSGPGSNYTIVGVIPSDALVMVEG
CVDAAKWCRVNHEGTSGWAAGDYLAMSVENTAVPMASGDPRVTYESVTYEEDRDGGSVLA
GGAAGAASGAAIAGPAGALIGGVLGMAGGDALDPPDTTTVTYVQQNPVEPVWLEGEVVTG
AAIPETVVLTPIPESTYAYSYVNGVPVIVDPNQRQIVQIVR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcaacagcacgctctggctctccgtggcagccgcgacgcttctcgccggcgcc
gcctcggcgcaggtgcaggaagcccgcccgatgaccgatctcaacctgcgctcgggcccc
ggctcgaactacacgatcgtgggcgtgatcccctcggacgcgctggtgatggtcgaaggc
tgcgtcgatgccgccaaatggtgccgcgtgaatcacgagggcacctcgggctgggctgcc
ggcgattacctcgccatgtcggtcgagaatacggcggtgccgatggcctcgggcgatccc
cgcgtgacctatgagtccgtgacctacgaggaagaccgcgacggcggcagcgtgctggcc
ggcggcgcagccggagcggcctcgggcgcggccatcgccggcccggccggcgctctgatc
ggcggcgtgctcggcatggccggcggcgatgcgcttgatccgccggacaccaccaccgtg
acctatgtccagcagaacccggtcgagccggtctggctcgaaggcgaagtcgtcaccggg
gcggcgatccccgagaccgtcgtgctgacgccgatccccgagagcacctatgcctacagc
tatgtcaacggcgtgccggtgatcgtcgatccgaaccagcgccagatcgtgcagatcgtc
cgctga

DBGET integrated database retrieval system