KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3537Help
Entry
RSP_3537          CDS       T00284                                 

Definition
alcohol dehydrogenase, zinc-containing (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RSP_3537
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_3537
  Lipid metabolism
   00071 Fatty acid degradation
    RSP_3537
  Amino acid metabolism
   00350 Tyrosine metabolism
    RSP_3537
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSP_3537
   00626 Naphthalene degradation
    RSP_3537
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSP_3537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:620643..621671
Genome map
AA seq 342 aa AA seqDB search
MPQRSDINRRVVLAQRPKGTPDESTLRMEEVPISEPAEGQMLLRTVWLSLDPYMRGRMND
TKSYAKPVEIGGVMTGQVVAEVMQSSLPGFEAGDMVLAGSGWQDYALSDGTEVVNLGKAP
ERPSRALGILGMPGYTAYAGLLKIGEPQPGETVVVAAASGPVGATVGQIAKLKGCRAVGV
AGGADKCRYVVETLGFDACIDHRAPDFEAQLAAACPNGIDIYFENVGGRVLYGVLPLLNP
FARMPVCGIVSWYNSPGLPEGPDMAPALMGTILRMKVKLQGFIIFDSFPRSLYAEFAREM
TGWLAEGKVKYREQVVEGLEAAPQALNDLLAGRNFGKMVVKL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagagatccgacatcaaccgccgcgtggtgctggcgcagcgtccgaagggcacg
cccgacgaaagcacgctccggatggaagaggtccccatttctgagcccgccgaggggcag
atgctcctgcggacggtgtggctgtcgctcgatccctacatgcgcgggcggatgaacgac
acgaaatcctatgccaagccggtcgagatcggcggggtgatgaccggacaggtggtggcc
gaggtgatgcagtcgagcctgcccgggttcgaggccggcgacatggttctcgcgggcagc
ggctggcaggattatgcgctgtcggacgggaccgaggtggtcaatctcggcaaggcgccc
gagcgtccctcgcgcgcgctcggcatcctcgggatgcccggatacaccgcctatgcaggt
cttctgaagatcggcgagccgcagcccggagagacggtggtggtcgcggcggcctccggc
ccggtgggggccacggtcgggcagatcgcgaagctgaagggctgccgtgccgtgggcgtt
gcgggcggcgccgacaagtgccggtatgtggtcgagacgctgggtttcgacgcctgcatc
gaccacagggcgccggatttcgaggcgcagctcgccgccgcctgcccgaacggcatcgac
atctatttcgagaatgtcggcggccgggtcctctatggcgtgctgccgctcctgaatccg
ttcgcgcggatgccggtctgcggcatcgtctcctggtacaacagtcccggcctgcccgag
gggccggacatggcgccggctctcatgggcaccatcctgcggatgaaggtgaagctgcag
ggtttcatcatcttcgacagtttcccgcgcagcctctatgccgaattcgcccgcgagatg
acgggctggctggccgagggaaaggtcaaatatcgcgagcaggtcgtcgaagggctggag
gccgcgccgcaggcgctgaacgacctgctggcgggacgcaacttcggcaagatggtcgtg
aagctctag

DBGET integrated database retrieval system