KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3572Help
Entry
RSP_3572          CDS       T00284                                 

Gene name
galM
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00010  Glycolysis / Gluconeogenesis
rsp00052  Galactose metabolism
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01120  Microbial metabolism in diverse environments
rsp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_3572 (galM)
   00052 Galactose metabolism
    RSP_3572 (galM)
Enzymes [BR:rsp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RSP_3572 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 3722086
NCBI-ProteinID: YP_355073
UniProt: Q3IWB2
Position
2:667152..668135
Genome map
AA seq 327 aa AA seqDB search
MTLTRFGTAPDGRPVQRIALAAGDLRLALLDRGAILQDLRLAGIDWPLTAGASDLAAYLG
PLRWFGAIVGPVANRIGGARACINGRPTRFVPNEGRTLLHSGAAGTHARHWQPVEVEAGR
ALLRLELADGIDGFPGNRRLEAEFVLDPPATLRLILTAVTDAPTLMNLANHSYWTLDPEP
GIGGQQLQIAAEHWLPVEAGLPTGEIRPVSGAMDFRAGRPLGETEGIDHNFCLASAQRDL
TEVARLTGRSGVRLTLATTAPGLQVYTGREIDSMPFAGHGGRPLRAFDAIALEPQLWPDA
PNRPEFPPITLAPGETFRQETRFSFSA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcacccgcttcggaaccgcccctgacgggcggcccgtccagcgcatcgccctg
gccgcaggcgacctccgcctggccctgctcgaccgaggcgccatcctgcaggacctgcgt
ctggccgggatcgactggccgctcacggcaggcgcgtccgacctcgcggcctatctcgga
ccgctccgctggttcggcgccatcgtcggtccggtcgcgaaccgcatcggcggcgcccgg
gcctgcatcaatggccggccgacccgcttcgtgccgaacgagggccggacgctcctccat
tccggggcggcgggaacccatgcccggcactggcagccggtcgaggtcgaggcgggccgc
gcgctcctgcggctcgaactcgcggacggcatcgacggatttcccggcaaccggcggctc
gaggccgagttcgtgctggacccgcccgcgacgctccggctgatcctgaccgcggtcacg
gatgcgccgacgctgatgaacctcgccaaccacagctactggaccctcgatcccgagccc
gggatcggcggccagcagctgcagatcgcggcggagcactggcttccggtcgaggccggc
ctgcctacgggcgagatccgccccgtatccggagcgatggacttccgcgcgggccgcccc
ctcggagagaccgaggggatcgaccacaatttctgcctcgccagtgcgcagcgagacctg
accgaggtggcgcgcctcaccggccggtcgggcgtccgtctcactctcgccaccaccgcc
ccgggcctgcaggtctataccggccgcgagatcgacagcatgcccttcgcgggccacggg
ggccgaccgctccgggccttcgacgccattgcgctcgagccgcagctctggccggacgcg
ccgaaccggccggagttccccccgatcaccctcgccccgggcgaaaccttccgccaggag
acgcgcttctccttctccgcctga

DBGET integrated database retrieval system