KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3572Help
Entry
RSP_3572          CDS       T00284                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSP_3572 (galM)
   00052 Galactose metabolism
    RSP_3572 (galM)
Enzymes [BR:rsp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RSP_3572 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:667152..668135
Genome map
AA seq 327 aa AA seqDB search
MTLTRFGTAPDGRPVQRIALAAGDLRLALLDRGAILQDLRLAGIDWPLTAGASDLAAYLG
PLRWFGAIVGPVANRIGGARACINGRPTRFVPNEGRTLLHSGAAGTHARHWQPVEVEAGR
ALLRLELADGIDGFPGNRRLEAEFVLDPPATLRLILTAVTDAPTLMNLANHSYWTLDPEP
GIGGQQLQIAAEHWLPVEAGLPTGEIRPVSGAMDFRAGRPLGETEGIDHNFCLASAQRDL
TEVARLTGRSGVRLTLATTAPGLQVYTGREIDSMPFAGHGGRPLRAFDAIALEPQLWPDA
PNRPEFPPITLAPGETFRQETRFSFSA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcacccgcttcggaaccgcccctgacgggcggcccgtccagcgcatcgccctg
gccgcaggcgacctccgcctggccctgctcgaccgaggcgccatcctgcaggacctgcgt
ctggccgggatcgactggccgctcacggcaggcgcgtccgacctcgcggcctatctcgga
ccgctccgctggttcggcgccatcgtcggtccggtcgcgaaccgcatcggcggcgcccgg
gcctgcatcaatggccggccgacccgcttcgtgccgaacgagggccggacgctcctccat
tccggggcggcgggaacccatgcccggcactggcagccggtcgaggtcgaggcgggccgc
gcgctcctgcggctcgaactcgcggacggcatcgacggatttcccggcaaccggcggctc
gaggccgagttcgtgctggacccgcccgcgacgctccggctgatcctgaccgcggtcacg
gatgcgccgacgctgatgaacctcgccaaccacagctactggaccctcgatcccgagccc
gggatcggcggccagcagctgcagatcgcggcggagcactggcttccggtcgaggccggc
ctgcctacgggcgagatccgccccgtatccggagcgatggacttccgcgcgggccgcccc
ctcggagagaccgaggggatcgaccacaatttctgcctcgccagtgcgcagcgagacctg
accgaggtggcgcgcctcaccggccggtcgggcgtccgtctcactctcgccaccaccgcc
ccgggcctgcaggtctataccggccgcgagatcgacagcatgcccttcgcgggccacggg
ggccgaccgctccgggccttcgacgccattgcgctcgagccgcagctctggccggacgcg
ccgaaccggccggagttccccccgatcaccctcgccccgggcgaaaccttccgccaggag
acgcgcttctccttctccgcctga

DBGET integrated database retrieval system