KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3692Help
Entry
RSP_3692          CDS       T00284                                 

Definition
Carbohydrate kinase, PfkB/Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSP_3692
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RSP_3692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(813344..814222)
Genome map
AA seq 292 aa AA seqDB search
MKVFVIGNVALDETLSIEDFPRPGASIFGAALSRDLGGKGANQAVAMGRTGLACIFVSAV
GQGPRGQEIAQRLAQEPLEAELVALEGVATDISIVLMSARGENAIITTREAASALTPEAA
AAALARGQTGDLLVLQGNLSAAATQAALRAARDAGMRTAFNPSPLQPYFGTLWPLVDTVF
LNEGEAEALGGVESLLAQGVGEIVLTLGAQGAELIRTTERTRVPAHPCAVVDTTGAGDCF
MAVALASAALRGTRLDARALNHAARAAAHTVGRAGTVAAFPNRAEMAAILAT
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcttcgtcatcggcaacgtggcgctcgacgagacgctttcgatcgaggacttt
ccccgtccgggggcctcgatcttcggggcggcgctgtcgcgcgacctcggggggaagggg
gccaaccaggcggtggcgatggggcggacggggcttgcctgcatcttcgtctcggccgtg
gggcaggggccgcgcggacaggagatcgcgcagcgtctggcccaggagccgctcgaggcg
gagctcgtggcgctggagggcgtggccacggatatctcgatcgtgctcatgtcggcacgg
ggcgagaatgcgatcatcaccacgcgcgaggcggcctcggcgctgacgccggaggcggcg
gccgcggcgctggcccgcggccagaccggggaccttctggtgctgcagggcaatctgagt
gcggcggccacgcaggcggcgctgcgcgctgcgcgagacgcggggatgcgcacggccttc
aacccctcgccgctccagccgtatttcggcacgctctggcctctggtcgacacggtgttc
ctcaatgaaggcgaagccgaggcgctcggcggggtggagagcctgctggcgcagggggtg
ggcgagatcgtcctcacgctgggcgcgcagggggccgagctgatccgtacgaccgagcgg
acgcgggtgcccgcccatccctgcgccgtggtggacacgaccggggccggggactgtttc
atggcggtggcgctggcctcggccgcgctgcgcggcacgcggctcgatgcacgcgcgctg
aaccatgcggcacgggcggcggcccacacggtcgggcgcgcgggcaccgtggcggccttt
ccgaaccgggccgagatggccgcgatcctcgccacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system