KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3695Help
Entry
RSP_3695          CDS       T00284                                 

Gene name
argE
Definition
(RefSeq) putative acetylornithine deacetylase (acetylornithinase)
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00300  Lysine biosynthesis
rsp01100  Metabolic pathways
rsp01120  Microbial metabolism in diverse environments
rsp01230  Biosynthesis of amino acids
Module
rsp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RSP_3695 (argE)
Enzymes [BR:rsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RSP_3695 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 3722185
NCBI-ProteinID: YP_355206
UniProt: Q3IVX9
Position
2:complement(815725..816819)
Genome map
AA seq 364 aa AA seqDB search
MTDLLTDVVALTRALIGFDTINPPGREAPAMRFCQELLERAGFACRLIDHGKHRASLIAE
RGPGGGLCFSGHLDTVPLGRAPWSREAHGGAVEGDRLYGRGSSDMKGGVAAFLVAAARSG
APVTVLLTAGEETGCDGARWLAEAGRLPRVRAMIVGESTGNRPLAGHKGALWLKLSTEGR
TAHGAAPHLGINAIGLMATTLARLTGWQPEAHHPRMGRATANLGTIRAGINVNSVPDLCE
LTVDLRSVEGVDHAALAAEVRGLCDPAVRVETLLDLPAVWTEPEDPWFARAAGQVRAVTG
PAEGPDCATYFTDASILKPAMGDPAVMILGPGSVDQPHGTDEHVLVSRLAEAVEIYAALI
AAGG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccttctcaccgatgtggtcgcgctgacacgcgcgctgatcggcttcgacacg
atcaacccgcccggccgcgaggctccggccatgcgcttctgtcaggagctgctggaacgc
gcgggcttcgcctgccgcctgatcgatcacggcaagcaccgcgcgagcctgatcgccgag
cgcggtccgggcggcgggctctgcttcagcggccatctcgacacggtgccgctcggccgc
gcgccctggagcagggaggcccatggcggcgcggtcgaaggcgaccggctctacgggcgg
ggcagcagcgacatgaagggcggcgttgcagccttcctcgtggcggcggcgcggagcggg
gcaccggtgacggtgctgctgacagcgggcgaggagacgggctgcgacggggcgcgctgg
ctggccgaagcgggtcgcctgccgcgagtgcgggcgatgatcgtgggcgagtcgaccggg
aaccgaccgctggcgggccacaagggcgcgctctggctgaagctctcgaccgaggggcgc
accgcgcatggggcggccccgcatctcgggatcaacgccatcggtctcatggcgacgacg
ctcgcccggctgacgggctggcagcccgaagcgcatcatccccggatggggcgggccacg
gcgaacctcggcacgatccgcgcgggcatcaacgtcaattccgtgcccgacctctgcgag
ctgaccgtcgatctgcgctcggtcgagggggtggatcatgcggcgctggcggccgaggtg
cggggcctctgcgatccggctgtccgggtcgagacgctgctcgacctgcccgcggtctgg
accgagccggaggatccgtggttcgcgcgcgcggcggggcaggtgcgggccgtgaccggc
cccgcggaggggccggactgcgccacctatttcaccgacgcctcgatcctgaagcccgcg
atgggcgacccggcggtgatgatcctcgggccgggctcggtcgaccagccgcatggcacg
gacgaacatgtccttgtctcgcggctggccgaggcggtggagatctatgccgcgctgatc
gcggcgggcggatag

DBGET integrated database retrieval system