KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3738Help
Entry
RSP_3738          CDS       T00284                                 

Definition
Carbohydrate kinase, PfkB family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSP_3738
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RSP_3738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:863421..864368
Genome map
AA seq 315 aa AA seqDB search
MTASKPGRIAVVGSNMVDLVTYITRMPAPGETIEAPDFEIGCGGKGANQAVAAAKLGSAV
SMVTKVGDDIFGENTRRNLAQHGIDIRHVETVAGKSSGVAPIFVEASGENSILIVKGANA
DLLPADVDTAEETLRAADLILMQMEVPRETVIHTVRRAAEWGVRTILNPAPAAADLNVDD
LRDLSFLVPNESELALISGLPTGSEEEIAAAALSLIERGIGTVIVTLGGRGARLVTRAGV
VPIAPVRVTPVDTTGAGDAFIGAFAHFLAATGEVEGALAHAARYAAHSVTGRGTQKSYAT
PEAFEAFCRALPPSA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatcgaaacccggccgcatcgcggtcgtcggctccaacatggtcgatctggtg
acctacatcacccggatgcccgcgcccggcgagacgatcgaggcgcccgacttcgagatc
ggctgcggcggcaagggcgccaatcaggcggtggccgccgcaaagctcggcagcgcggtc
agcatggtgacgaaggtcggcgacgacatcttcggcgagaacacccgccgcaacctcgcc
cagcacggcatcgacatccgccatgtggagacggtggcgggcaagtcctcgggcgtggcg
ccgatcttcgtcgaggcgtcgggcgagaattcgatcctgatcgtgaagggcgcgaatgcc
gaccttttgcccgccgatgtggatacggccgaagagacgctgcgcgcggccgacctgatc
ctgatgcagatggaggtcccgcgcgagacggtgatccataccgtgcggcgggcggcggaa
tggggcgtgcgcaccatcctgaaccccgccccggccgcggccgacctgaatgtggatgac
ctgcgcgacctgagcttcctcgtgccgaacgagagcgagcttgcgctgatctcgggcctg
cccaccggcagcgaggaggagatcgcggccgccgccctgagcctgatcgagcgcggcatc
ggcacggtgatcgtgacgctgggcgggcgcggcgcccggctggtgacccgcgcgggcgtg
gtgcccatcgccccggtccgggtgacgcccgtcgacacgaccggcgcgggcgatgccttc
atcggcgccttcgcccatttcctcgccgcgaccggcgaggtggagggcgcgctggcccac
gccgcgcgctatgccgcccattccgtgacggggcgcggcacccagaaatcctacgccacg
ccggaggccttcgaggccttctgccgcgcgctccccccatccgcatga

DBGET integrated database retrieval system