KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3743Help
Entry
RSP_3743          CDS       T00284                                 

Gene name
speB1
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rsp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(868722..869684)
Genome map
AA seq 320 aa AA seqDB search
MSVLPTDSLSTPRFVGLPSFMRLPMATELQGLDAAIVGLPSDSGAPFRTGARFAPNALRA
MSVMLRPINPYRGHINIFEVLRVADAGDATCVPGYEIESLAALERALDAVVEAGAVPFGI
GGDHSVSLAGLRAVAKRHGPLGLVHFDSHTDTWDSYFDGKRYSAGTMFRRAIEEGIVDPA
RSIQVGMRGSLFQPADVSQSVDLGLEVITCDEMFALGLPETARRIAARSAGHPAFLSFDL
DFVDPAYAPGVETPECGGPTARETLSLLRSLQGLNLVGCDVVELNPSYDGPGQITALLGA
TVMAELLAILAEARVRERSR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcctgcccaccgattcgctctccaccccccgcttcgtcggcctgccgagcttc
atgcgcctgcccatggccacggagcttcaggggctcgacgccgccatcgtcggcctgccc
tcggattcgggcgcgcccttccgcaccggcgcgcgcttcgcgccgaacgcgctgcgcgcc
atgtcggtgatgctgcgcccgatcaacccctaccgcggccacatcaacatcttcgaggtc
ctgcgcgtggccgatgcgggcgacgcgacctgcgtgccgggctacgagatcgagagcctc
gccgcgctcgaacgggcgctcgacgcggtggtcgaggccggcgccgtgcccttcggcatc
gggggcgaccactcggtctcgctcgccggtctccgggcggtggccaagcgtcacgggccg
ctcggcctcgtgcatttcgacagccacaccgacacctgggacagctacttcgacggcaag
cgctacagcgccggcaccatgttccgccgggccatcgaggagggcatcgtcgatcccgcc
cgctcgatccaggtggggatgcgcggctcgctgttccagccggccgatgtcagccagtcg
gtcgatctcggcctcgaggtcatcacctgcgacgagatgttcgcgctgggactgcccgag
accgcccgccggatcgccgcgcgcagcgcaggtcacccggccttcctgagcttcgatctc
gatttcgtggatcccgcctatgcgcccggcgtcgagacgcccgagtgcggcggccccacc
gcgcgcgagacgctctcgctgctgcgcagcctccagggcctcaacctcgtcggctgcgac
gtggtcgagctcaatccttcctatgacggtccgggccagatcaccgccctgctcggggcc
accgtcatggccgagcttctggcgatcctcgccgaggcgcgggtccgcgagcggtcacga
taa

DBGET integrated database retrieval system