KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3823Help
Entry
RSP_3823          CDS       T00284                                 

Gene name
proB1
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSP_3823 (proB1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RSP_3823 (proB1)
Enzymes [BR:rsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RSP_3823 (proB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:18932..20044
Genome map
AA seq 370 aa AA seqDB search
MPLQAPDIRSAKRLVVKIGSALLVDGEGLRRQWLSALALDVAEARTRGTQVILVSSGSIA
LGRRVLHLPPGPLALEQSQAAAAVGQIRLARAYEEVLAPHGITTAQVLVTLEDTEDRRRY
LNSRATMETLLGLGTVPIVNENDTVATDEIRFGDNDRLAAQIAVTVGADQLVLLSDVDGF
YSANPKEDPTAERFDLVETITPALEAMAGDPVSGLSKGGMKTKIMAAKTAVAGGCAMAIT
EGSAMRPLKALEQGAARTWFVAQGDPQAARKRWINAMKPRGTIRVDAGAVQALQAGKSLL
PAGVVAVEGNFGRGDPVEIAGPMGEVLGRGLTRYTAVEAVQIAGHRSAEIVAILGYSGRA
ALIHRDDMVI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccgcttcaggcgccggatatccgcagcgccaagcgtctggtcgtgaagatcggctcg
gcgctcctcgtggatggcgaggggctgcgccgccaatggctctcggcgctggcgctcgac
gtggccgaggcgcggacgcggggcacgcaggtgatcctcgtctcctcgggctcgatcgcg
ctcgggcggcgggtgctgcatctgccgccggggccgctcgcgctcgaacagagccaggcg
gcggcggccgtgggccagatccggctcgcccgcgcctatgaggaggtgctggccccgcac
ggcatcaccaccgcgcaggtgctggtcacgctcgaggataccgaggaccggcggcgctac
ctcaattcccgcgccacgatggagacgctgctcgggctcggcaccgtgcccatcgtgaac
gagaacgacacggtcgccaccgacgagatccgcttcggcgacaacgaccggctggccgcg
cagatcgcggtgacggtgggggcggatcagctcgtgctcctgtccgacgtggacggcttc
tattcggccaatcccaaggaagatcccaccgccgagcggttcgatctggtcgagacgatc
acgcccgcgctcgaggcgatggcgggcgatccggtttcgggcctgtccaagggcggcatg
aagaccaagatcatggcggccaagaccgccgtcgccggcggctgcgccatggcgatcacc
gaaggctcggcgatgcggccgctcaaggcgctggaacagggcgcggcgcgcacctggttt
gtggcgcagggcgacccgcaggcggcgcgcaagcgctggatcaacgcgatgaagccgcgc
ggcacgatccgggtggatgcgggtgcggtgcaggcgctgcaggcgggcaagtcgctgctg
cccgcgggcgtggtggcggtcgagggcaatttcgggcgcggcgatccggtcgagatcgcg
gggcccatgggcgaggtgctgggacgcgggctcacccgctacacggcggtcgaggcggtg
cagatcgcgggccaccgctcggccgagatcgtggccatcctcggctacagcggccgggca
gccctcatccatcgcgacgatatggtgatctga

DBGET integrated database retrieval system