KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3937Help
Entry
RSP_3937          CDS       T00284                                 

Definition
(RefSeq) putative transposase protein, Y4bF
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_29 rve HTH_32 HTH_28 HTH_23 DUF3663 HTH_Crp_2
Motif
Other DBs
NCBI-GeneID: 3722013
NCBI-ProteinID: YP_354819
UniProt: Q3IX16
Position
2:371717..373093
Genome map
AA seq 458 aa AA seqDB search
MGWVLMSERELNRIEILSKVLDRRMTTTEASVLLAIGPRQVQRLLRRLREDGAAATRHGL
RGRPSNHRLSPGLRDLALALVRETYVDFGPTLAAEKLAERDGLHVSRETLRKWMVEDGLW
LSRPQRRRFHQPRLRREHLGELVQIDGSDHHWFEDRAPACTLLVFIDDATSRLMEMRFVP
SESTFAYFAALECYLTRHGRPTAFYSDKHSVFRVARQDARTGHGMTQFGRALAELNIEIL
CANSSQAKGRVERANRTLQDRLVKEMRLAGISDMEAGNAFLPGFIERHNAQFARVPARPD
DRHRPLNLPPDRLADILCWRDQRYVGNQLTFTYEHRRILLEESDLTRGIVGKYVDTYAFP
DGRFEARWKGISLPYRSFDPEQQHVTHAAITANKRLSDVLALARSLQESQPPRVSRVGRQ
RTVYEPTGRRNDGWNSKLARRARQRADGTAKPPDIAAE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgggatgggtgctgatgagcgagcgcgaactgaaccgcatcgagatcctgtcgaaggtg
ctcgatcggaggatgacgacgacggaagcctcggttctgctggcgatcggcccgcgtcag
gtgcagcgtctgctgcgacggttgcgcgaggacggcgcggcggcaacgcggcacgggttg
cgcgggcgaccgtcgaaccaccgcctctcgccgggattgcgggaccttgcgctggccctc
gtgcgggagacctacgtcgatttcggccccacgctcgcggccgagaagctggccgagcgc
gacggcctgcatgtgtcgcgggagacgctgcggaagtggatggtcgaggatgggctctgg
ctgtcgcgtcctcagcgccggaggtttcaccagccgcggctgcggcgcgagcacctgggc
gaactggttcagatagacgggtccgatcatcattggttcgaggatcgcgcaccagcctgc
acgctgctcgtcttcatcgacgacgcgacgagccggctgatggagatgcgcttcgtgccc
tccgagagcaccttcgcctatttcgcggcgctggagtgctacctgacgcggcacggcagg
cccacggctttctactccgacaagcattcggtcttccgcgtggcgaggcaggacgcgcgg
accggccatggcatgacgcagttcggccgggcgctggccgagttgaacatcgagatcctc
tgcgccaactcctcgcaggccaagggccgggtcgagcgggcgaaccgcaccttgcaggac
cggctggtcaaggagatgcggcttgcaggcatcagcgacatggaggccgggaacgccttc
ctgcccggcttcatcgagcggcacaacgcgcagttcgccagggtgcctgcccggccggac
gaccggcaccggccgctgaacctgcccccggaccggctggccgacatcctgtgctggcgc
gaccagcgctacgtcgggaaccagctcaccttcacctacgagcaccggcggatcctgctg
gaggaaagcgacctcacgcgcggcatcgtggggaaatacgtcgacacctacgccttcccg
gacggacgttttgaagctcgatggaaaggcatctcgctcccctaccgcagcttcgatccc
gagcagcagcatgtcacccacgcggccatcaccgcgaacaagcggctcagcgacgtcctg
gcgctggcgaggagcctgcaggaaagccaacccccgcgcgtgagccgcgtcggccggcag
cgcacagtctacgagccgacgggtcggcggaacgacggctggaattcgaaactggcccgc
cgcgccaggcagcgggcggacgggacggcgaagcctcccgacatcgcggcggaatga

DBGET integrated database retrieval system