KEGG   Rhodobacter sphaeroides 2.4.1: RSP_6214Help
Entry
RSP_6214          CDS       T00284                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsp01100  Metabolic pathways
rsp01110  Biosynthesis of secondary metabolites
rsp01130  Biosynthesis of antibiotics
rsp01230  Biosynthesis of amino acids
Module
rsp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSP_6214 (trpC)
Enzymes [BR:rsp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RSP_6214 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C
Motif
Other DBs
NCBI-GeneID: 3719333
NCBI-ProteinID: YP_352051
UniProt: Q9ZFA7
Position
1:complement(598410..599222)
Genome map
AA seq 270 aa AA seqDB search
MSTILDRIKAYKLEEIAARKAERPLVAVEDAARAAPAPRGFARALSTAAATGYGLIAEIK
KASPSKGLIREDFDVPALARAYETGGATCLSVLTDGPSFQGADDFLRQAREAVKLPCLRK
DFLYDTYQVAEARALGADCILIIMASVTDSQALELEAAASHWGMDVLVEVHSREELARAE
HLKSRLIGINNRNLDTFEVSLDVTRDLARRVPEDRLIVSESGLHTPEDLADLARYGARCF
LIGESLMRQADVEAATRAILADPLTAQGGV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccattctcgaccgcatcaaggcttacaaactggaagagatcgcggcccgcaag
gccgagcgccccctggtggccgtagaggatgcggcccgcgccgcccccgcgccgcgcggc
ttcgcccgcgcgctctcgacggccgcggccaccggctacgggctcattgccgagatcaag
aaggcgagcccctcgaagggcctcatccgcgaggatttcgacgtgcccgccctcgcccgc
gcctacgagaccggcggcgccacctgcctctccgtcctgaccgacggcccctcgttccag
ggcgccgacgacttcctgcgtcaggcccgcgaggcggtgaaactgccctgcctgcgcaag
gatttcctctacgacacctatcaggtggccgaagcgcgggcgctcggcgccgactgcatc
ctcatcatcatggcgagcgtgaccgacagtcaggcgctggagctcgaggcggcggccagc
cactggggcatggatgtgctggtcgaggtccattcccgcgaggaactggcccgcgccgaa
catctgaagtcgcggctgatcggcatcaacaaccgcaatctcgacacgttcgaggtctcg
ctcgacgtgacgcgcgatctggcgcgccgcgtgcccgaggatcggctgatcgtctccgag
agcgggctccacacgcccgaggatctggccgatctcgcccgctacggcgcgcgctgcttc
ctgatcggcgagagcctgatgcggcaggcggatgtcgaggccgcgacgcgcgcgatcctc
gccgatccgctgacggcacaggggggggtctga

DBGET integrated database retrieval system