KEGG   Rhodobacter sphaeroides 2.4.1: RSP_6235Help
Entry
RSP_6235          CDS       T00284                                 

Definition
(RefSeq) hypothetical protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Reo_sigmaC
Motif
Other DBs
NCBI-GeneID: 3722000
NCBI-ProteinID: YP_354807
UniProt: Q3IX28
Position
2:358411..360420
Genome map
AA seq 669 aa AA seqDB search
MSSSHLKHLFPILGALVLLPVMAGAESARTTVAGPDSGGAMESSYRSIVGLLEAEIAGLE
ARITVLTTERRREMTRLQEAREETAQAEKRLAQLHREQLRLEEGVRAAAVQPVGLLAAPA
GKARPDAGSAQLEAERQRLTELVRDLGRQAEDARSRLGKMAATVAAREADLNGLAERHAG
LTRAVAQREADLAALEARDAEEAKRLSDRQAAVKGLEARQAQLLQAVAQREEQLAGLERR
RGDLSALIERRESETAAQQAAAVARHQDKVASLSGQRDALARAVKALAEEEARRMEALAA
SEAQLAAASAERDRALAEARTASSQVGETRSLAAAQAEVDARATALATAEEEIRARAAAL
EKGESEARSRAAALQAAEEEVRARSAALEAAEAEAQQRAEVLRVQEGLFKEQRAAADTET
GQRAQAVAEAEAAAKAAEQARADAVREAEAARTAEAEARSRAEALKRELSEGEASLGRLT
EAVGAAEARLAALEVEGHKRAEAQTQALSEADAQLAALEAARREKAKALSDAEAGLTALE
ADQRTQAEAQTKARAEAEARLAELAQREEAARARLAEVEAAPQPAVTPVVEAPPAPPEAA
PARRPARDAAVVAAALAGAPGMPAPGSAPHQKLAGLLQAGVCPVDALRTATGTVNRQSLV
ALVRSLGGC
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgagtcatttgaagcatctatttccaattctgggggccctcgtgctcctgccg
gtcatggcgggtgccgaatcggctcggaccacggtggccggcccggattcgggcggcgcc
atggaaagctcctatcggtcgatcgtggggttgctcgaggcagagattgccgggctcgag
gcgcgcatcaccgtgctgaccaccgagcggcggcgcgagatgacgcgccttcaggaggca
cgcgaggagaccgctcaggccgagaagcgtctggcgcagcttcaccgtgagcagctccga
ctggaggagggggtgcgggcggcggcggtgcagccggtcgggctgctggcggcaccggcg
ggcaaggcgcgccccgatgcagggagtgcgcagctcgaggccgagcggcagcggctcacc
gaactggtccgggatctcggccggcaggcggaggatgcccgctcgcgactgggcaagatg
gccgcgaccgtcgccgcacgcgaggcggatctgaatgggcttgccgagcggcacgcgggt
ctgacccgggccgtggcgcagcgggaggcggatctggcggcgcttgaggcgcgggatgca
gaggaagcgaagcggctctccgaccggcaggcggcggtaaaggggctcgaggcgcggcag
gcgcagctcttgcaggccgtggcacagcgcgaagagcagctcgccgggctcgagcgtcgt
cggggcgacctctccgccctgatcgagcggcgcgagagcgaaacggcggcgcagcaggcg
gcagcggtggcgcggcatcaggataaggtggcctcgctttccgggcagcgcgacgcgctg
gcgcgcgcggtcaaggcgctggcggaggaggaggcgcggcgcatggaggcgctggcggcc
tccgaggcgcaactggccgccgcttcagccgagcgggaccgcgctctggccgaagcccga
accgcgtcatcccaagtcggggagacgcgcagccttgccgccgcgcaggccgaggtggac
gcccgcgccacggccctcgcgaccgcggaggaggagatccgggcacgggccgcggcgctc
gagaagggcgagagcgaggcgcgcagccgcgcggcggcgctgcaggcggccgaggaagag
gtgcgggcgaggtcagcggctctggaggcggcagaagcggaagcgcagcagcgggcagag
gtcctgcgggttcaggaggggcttttcaaggagcagcgcgcggccgccgacaccgagacc
gggcagcgggcgcaggcggtggccgaggccgaagctgcggcgaaggccgccgagcaggcc
cgggccgatgcggtgcgcgaagccgaggccgcgcgcaccgccgaggccgaggcgcggtcg
cgggccgaggcccttaagcgcgagttgagcgagggcgaggcatccctcggacgcctgacc
gaagccgtcggcgcggccgaagcgcgtctcgcggccctcgaggtcgaaggccacaagcgg
gccgaggcgcagacgcaggcactgtcggaagcggacgcccaactggccgcgctcgaggcg
gcgcgtcgggagaaggcgaaggctctgtccgacgccgaggcgggactgacggcactcgag
gcggaccagcggacgcaggccgaggctcagaccaaggcgcgggcggaggcagaggcccgc
ctcgccgaactcgcgcagcgcgaagaggcggcgcgggcgcgactcgcggaggtggaggcc
gcccctcaaccggccgtgacgcctgtcgtcgaagcccccccggcgccgcctgaggcagca
ccggccagaaggcccgcgcgggatgcggccgtggtcgccgcggcgctggcgggcgctccg
gggatgcccgcgccgggcagcgcgccgcaccagaagctcgcgggtctgcttcaagcgggc
gtctgcccggtcgatgccctccgcaccgcgacggggaccgtcaaccgccagtcgctcgtg
gccctcgtccgatccctcggcggctgctga

DBGET integrated database retrieval system