KEGG   Rhodobacter sphaeroides 2.4.1: RSP_7597Help
Entry
RSP_7597          CDS       T00284                                 

Definition
(RefSeq) hypothetical protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2:complement(368310..368633)
Genome map
AA seq 107 aa AA seqDB search
MITETTERRRALFRSRRTAPPPSTRDEAVRSAEPDETSCIWKATGLCPGQDELDARGHMA
CLCAQVLMAPSPDRVIDTLTDLGLTDAQIGRYFHIPVRCVMALRRPA
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgataaccgaaacgaccgaacggcgccgggccctgttccgcagccgcaggaccgctccg
cccccatcgacccgtgacgaggccgtccgttcggcagagcccgatgaaacgagctgcatc
tggaaggcgaccggcctctgccccggtcaggatgaactggacgcccgcggccatatggcc
tgcctctgcgcgcaggtgctgatggcgccctcgcccgatcgggtgatcgatacgctcacc
gatctcggcctcacggacgcccagatcgggcgctacttccacatcccggtccgctgcgtc
atggcactgcggcgcccggcataa

DBGET integrated database retrieval system