KEGG   Rhodobacter sphaeroides 2.4.1: RSP_7598Help
Entry
RSP_7598          CDS       T00284                                 

Definition
(RefSeq) hypothetical protein
Organism
rsp  Rhodobacter sphaeroides 2.4.1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 17312420
NCBI-ProteinID: YP_008686459
UniProt: U5NRM4
Position
2:complement(375597..375812)
Genome map
AA seq 71 aa AA seqDB search
MSLIEDLKKQIATAEARIREIQLGCPHPEVAMIVRGIGYQDEPDKEFRHCTCGLCEAQFT
RGMVDKKEGGR
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgatcgaagacctgaagaaacagatcgccaccgccgaggcgcgcatccgggaa
atccagctcggctgcccgcatccggaggtggcgatgatcgtgcgcgggatcggctaccaa
gacgagccggataaggagtttcgccactgcacctgcggtctgtgtgaggcacagttcacg
cggggcatggtcgacaagaaggagggcggccggtga

DBGET integrated database retrieval system